(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE241

ASFUM1_6.PE241       Location/Qualifiers
FT   CDS_pept        join(complement(773547..773834),complement(773173..773496))
FT                   /codon_start=1
FT                   /gene_family="HOG000201761" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264303"
FT                   /orf_name="AFUA_6G03560"
FT                   /product="IgE-binding protein, putative "
FT                   /protein_id="EAL85683.1"
FT                   /db_xref="HOGENOM:HBG051349"
FT                   /db_xref="HOGENOM:HBG325733"
FT                   /db_xref="UniParc:UPI000051FB4F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD55"
FT                   /transl_table=1
FT                   /translation="MKIPVLFSLLTLASAVSIPIRNNGHSNSYSYHTSNSTKFSVMSAR
FT                   SGSPIHLLPMNAAHGNFWLGESPSTFCPEPVEKVSGCPPGTTTRFASANALDVAVPGGQ
FT                   RIYVDPRGALRFTTAHSGSIPPGSSTGPFVHSAGTPFGHFAYKGQGAKGFIACPKSNGT
FT                   ATHWQVYASVANVASGAECLGFNALAVPSNDTRAAAWEYI"
     atgaagatcc cggttctttt ctcactcctc accctggcct ctgccgtcag catccccatc        60
     cgcaacaatg gccacagcaa cagctacagc taccacacca gcaacagcac gaaattctcc       120
     gtcatgtccg cccgctccgg ctcgcccatc cacttgctcc ccatgaatgc agcccacggc       180
     aacttctggc tcggcgagtc cccctccacc ttctgccctg agcccgtcga gaaggtcagc       240
     ggctgccccc caggcaccac cacccggttc gccagcgcga acgccttgga cgtcgccgtc       300
     cccggcggcc agcgcatcta cgttgacccc cgcggtgccc tccgcttcac caccgctcac       360
     tcgggctcca tcccccctgg ctcctctacc ggtccctttg tccacagcgc cggcacgcca       420
     ttcggacact tcgcctacaa gggccagggc gccaagggct tcatcgcttg ccccaagagc       480
     aatggcaccg ccacgcactg gcaggtgtat gcctctgttg cgaacgttgc cagcggtgcg       540
     gaatgtctcg gtttcaatgc tttggcggta ccttcgaatg acactcgggc tgccgcttgg       600
     gagtatatct aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page