(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE247

ASFUM1_6.PE247       Location/Qualifiers
FT   CDS_pept        join(complement(794196..794205),complement(794017..794145),
FT                   complement(792628..793969),complement(792141..792558))
FT                   /codon_start=1
FT                   /gene_family="HOG000044189" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264307"
FT                   /orf_name="AFUA_6G03630"
FT                   /product="Very-long-chain acyl-CoA synthetase family
FT                   protein (CefD1), putative"
FT                   /EC_number="6.2.1.-"
FT                   /function="ligase activity"
FT                   /protein_id="EAL85676.2"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG058423"
FT                   /db_xref="HOGENOM:HBG712034"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0000F51CE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD62"
FT                   /transl_table=1
FT                   /translation="MSLGVAAAAVAGGATLAAYLNAKFHITKDISTLYVAWKSNRSFEQ
FT                   AAAKGLGNVWFVFLETAAKYPDMVCMWTREGIYTYRDVQNLACQYAHYFLAQGVKQGDL
FT                   VAFYLQNRAEFMIAWLALCSIGCAPAAINYNLTGDALVHCLKISGAKLVLVDDDEACRA
FT                   RIDDSRAAIEGPLGMELIYLDHSFASQVSSFPTTKPPKEFAQSMSGADPAILLYTSGTT
FT                   GMPKGCAFTMARLYSTLALRRGSMEDTDGPGGDIWYSCMPLYHGTAAVAMMVCLTTGVS
FT                   IALGKKFSVRNFWRDIRDSHATVFVYVGEVARYLLAAPPSPDDRNHSVRCMYGNGLRPD
FT                   IWEKFQQRFGISAVAEFFNSTEGLFGLFNLNKGPFTAGSVGHHGLLMRAIMHNTFVPVA
FT                   IDPTTGDVLRDPKTGFAMRAPYDQGGEILVNVPNEQAFQGYWRNESATSKKFLRDVFTK
FT                   GDLWYRSGDALRRQSDGRWYFLDRLGDTFRWKSENVATAEVAEILGRYPGIQEANVYGV
FT                   LVPHHEGRAGCAALHLSPEAREAFDFRGLAAFARARLPRYAVPVFLRIVETSAHIHNHK
FT                   QNKVPLREEGIDPAKIGSKVPEGRDDKFYWLPPGADGYVEFGKREWETMLAGSARL"
     atgagtctag gcgtcgcggc agccgcagta gcaggaggtg ctacgctggc ggcgtatctg        60
     aacgccaagt tccacatcac caaagacatc tcgactctgt atgtcgcatg gaaaagtaat       120
     cgttcctttg aacaagccgc cgccaagggt cttggaaatg tctggtttgt gttcctggaa       180
     acagcagcga agtacccgga tatggtgtgc atgtggacac gggagggaat ctatacctac       240
     cgggacgtcc agaaccttgc ctgccagtat gcgcactact tcctggccca aggggtcaag       300
     caaggggacc tggtggcctt ttacttgcag aaccgggccg agttcatgat tgcgtggctt       360
     gctctttgca gtattggatg tgcccctgct gcgatcaact ataatcttac cggtgatgca       420
     ttggtgcatt gtctcaagat cagcggagcc aagcttgttc tggtggatga cgatgaagca       480
     tgtcgcgcgc gcatcgacga cagcagagca gctatcgaag gcccactcgg catggaactt       540
     atctacctgg accactcgtt cgcctcgcaa gtctccagct tccccacgac gaagccaccc       600
     aaggagttcg cacagagcat gtcgggcgcg gatccggcca tcctcctgta cacctccggc       660
     accaccggca tgcccaaggg ctgcgcattc accatggcac gattgtacag cacgctggct       720
     ctgcgtcgcg gatcaatgga ggacaccgac ggtcccggcg gggacatctg gtacagctgc       780
     atgccgctgt accacggcac agccgccgtc gccatgatgg tctgcctcac caccggcgtc       840
     agcattgccc taggcaagaa gttcagcgtg cgcaacttct ggcgcgatat ccgagactcc       900
     cacgccacgg tctttgtgta cgtcggcgaa gtggcccggt acctgctggc cgcaccgccg       960
     tcgccggacg accgcaacca cagcgttcgc tgcatgtatg gcaacggact gcgaccggac      1020
     atctgggaga agttccagca aaggttcggg atcagtgccg tggccgagtt cttcaacagc      1080
     accgaggggc ttttcgggct gttcaatctc aacaagggcc cgtttacggc ggggagtgtc      1140
     ggtcaccacg gcctgctcat gcgcgccata atgcacaaca cgttcgtgcc tgtggcgatc      1200
     gatcccacga ccggcgatgt cctgcgggac cccaagacgg ggtttgcgat gcgggcccca      1260
     tacgaccaag gcggcgagat cctcgtcaat gtgcccaacg agcaagcatt ccaaggctac      1320
     tggcgcaatg aaagcgccac gtccaagaaa ttcctgcgcg atgtcttcac gaagggggat      1380
     ctgtggtacc gctctggcga tgcgctacgc cgccagagcg acggccgctg gtactttctc      1440
     gatcggctcg gcgatacctt tcgatggaaa tccgagaatg ttgcaactgc cgaggtggcc      1500
     gaaatcctcg gccgataccc cggcatccaa gaagccaacg tctacggcgt cctggtcccc      1560
     caccacgaag gccgcgctgg ctgcgcagcg ctccatctca gcccggaggc gcgagaggca      1620
     ttcgactttc gcggtctggc tgcgtttgcg cgcgcacgac tgccccggta cgctgtcccg      1680
     gtgtttctgc ggatcgtgga gacgtcggcg catatccaca accacaagca gaacaaggtg      1740
     cccttgcgcg aggaggggat cgacccggct aaaattggga gcaaggtgcc tgaggggcgg      1800
     gatgataagt tctactggct tccgccaggg gcagatggat atgttgagtt tgggaagagg      1860
     gagtgggaga cgatgctggc gggaagtgct cgtttgtag                             1899
//

If you have problems or comments...

PBIL Back to PBIL home page