(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE25

ASFUM1_6.PE25        Location/Qualifiers
FT   CDS_pept        join(complement(94234..94388),complement(94037..94154))
FT                   /codon_start=1
FT                   /gene_family="HOG000048658" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902577"
FT                   /orf_name="AFUA_6G00350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84230.1"
FT                   /db_xref="HOGENOM:HBG056388"
FT                   /db_xref="UniParc:UPI0000520530"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Y9"
FT                   /transl_table=1
FT                   /translation="MTPRAGAPVGSRLAAHAAAFVSTEGHDMHIAMAGTSRYDDDERQF
FT                   VPPNFHKSLEELLKRYLPENLGLQFQADANQLEELANEVANTEAR"
     atgacgccga gggcaggagc tcctgtcggg agcaggttag ccgcacacgc tgccgctttt        60
     gtcagcactg aaggccatga tatgcatatt gcaatggcgg ggacgtcgag atatgacgat       120
     gatgagcgcc aatttgtgcc gccgaacttt cacaagtcgc ttgaagagct tctgaaacgc       180
     tacctgcccg agaacttggg cttgcagttc caggcagacg caaaccagct tgaggagcta       240
     gccaacgagg tcgcaaatac tgaggctcga tag                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page