(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE253

ASFUM1_6.PE253       Location/Qualifiers
FT   CDS_pept        join(complement(816320..817408),complement(815810..816262))
FT                   /codon_start=1
FT                   /gene_family="HOG000217810" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207676"
FT                   /orf_name="AFUA_6G03700"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85669.1"
FT                   /db_xref="HOGENOM:HBG056250"
FT                   /db_xref="UniParc:UPI000051F8D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD69"
FT                   /transl_table=1
FT                   /translation="MRRPADLQTALLPGCTHDSSLQAANSLVLSGSDRSRLNYLQDSVL
FT                   VTILGKQWPWSTVSYTYHRVAVKEPMVMSMILATTASEIHRSRLHDSDSTCLYSAAGDF
FT                   SDIDGRVHYGTALSRLREALAEGVKTSSKLEAVFITLWLMIDYENRFGSGASTINIHLQ
FT                   GIESILHNHILPLLKYEDCSAAAITAESPGAAGLLFDNSAEGASLTERVARSPVDSVAG
FT                   PSAGKLVYTAVPLFLLWTLYFFTPGALFFGPGAVYEPGFEKVNDDLYRLFRLFLHAEDE
FT                   NTRLNLENLYRISRQSPSKFWGEAYPAKAQLDDLENYPGLALYHKSHVVQFRITELFRQ
FT                   ARGTPWNEAPYQQTVDEIIRIANEFEMLLSSAKAAPSCDIVGDGRRVMETIYWAAITYY
FT                   STIVYFHLCFDRLLPDNLQTVLMPQEKAVSLVLELSLKLHRSRPHLMVRITWPLFMAGV
FT                   ATADRIYQDWVSIRLRELGRYGQNYSRISQRFDEIIRGSDPFAYSQKQLPYYNAD"
     atgaggagac cggctgattt gcaaactgcc ttgcttcctg gttgcaccca tgacagtagt        60
     ctgcaagctg ccaattcact tgtcctctcg ggatctgaca ggtctcgctt gaactatctt       120
     caagattctg tcctggtcac tatactcggc aagcagtggc cgtggtccac cgtttcctac       180
     acctaccata gagtagctgt caaggaacct atggtgatga gcatgatcct cgccacgact       240
     gctagtgaaa tccatcgatc acgtctccac gattccgaca gcacatgttt gtattccgca       300
     gccggtgatt tctctgacat cgatggcagg gtgcactacg gcacagcgtt atcgagactc       360
     cgtgaagcac tagccgaagg cgtgaagacg tcgtcgaagc tcgaggcggt gttcataacg       420
     ttgtggctga tgatcgatta cgagaaccgg tttggtagtg gggcatctac aatcaatatt       480
     catttgcaag gcattgaaag catactgcac aaccatatct tacctctgct gaaatacgag       540
     gactgttcgg ccgccgcaat tactgccgag agccctggag cggcaggatt gctgtttgac       600
     aattctgccg aaggtgcgag tttgactgag agagtggcca ggagtccggt cgattcggta       660
     gctggtccat ctgcggggaa actagtttac acggcagtgc ctctattctt gctgtggacc       720
     ctctacttct ttacgcccgg cgcgcttttc tttggccctg gggctgtata tgaaccaggg       780
     tttgagaaag tcaacgatga tctctaccgt ctcttccgtc tcttccttca tgcagaagat       840
     gaaaacacgc ggttgaacct agagaacctc tatcgtatca gtaggcagtc gccttcgaag       900
     ttctggggag aagcctaccc agccaaagca caactagacg acctggaaaa ctatcctggg       960
     ttagcgctct accacaagag ccatgtggtt caattcagaa tcaccgagct atttcggcaa      1020
     gcaagaggca ccccgtggaa cgaagcacct tatcagcaga ctgtcgatga gataatcaga      1080
     atagccaatg agttcgagat gcttctctca tctgccaaag ccgccccgtc gtgtgatatt      1140
     gtgggagacg ggcgccgcgt gatggagaca atctattggg cagccatcac atactacagc      1200
     acgattgtct acttccacct ctgctttgac aggctgctcc cagacaactt gcagacagtg      1260
     ttgatgccgc aagaaaaggc cgtctcccta gtcctggagc tatcgctcaa gctccatcga      1320
     agcaggccgc atctcatggt gcgcatcacg tggccactct tcatggccgg cgtggctacc      1380
     gccgacagga tctatcagga ttgggtatct atccggctgc gagagttggg gcggtatggg      1440
     cagaattaca gccgtatcag ccaacgcttt gacgagatta ttcgcggaag cgaccctttt      1500
     gcatattctc agaaacaact tccgtattac aacgctgatt ga                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page