(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE259

ASFUM1_6.PE259       Location/Qualifiers
FT   CDS_pept        830413..831825
FT                   /codon_start=1
FT                   /gene_family="HOG000201727" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903125"
FT                   /orf_name="AFUA_6G03760"
FT                   /product="HhH-GPD family base excision DNA repair protein "
FT                   /EC_number="4.2.99.18"
FT                   /function="DNA binding"
FT                   /function="DNA-(apurinic or apyrimidinic site) lyase
FT                   activity"
FT                   /biological_process="base-excision repair"
FT                   /protein_id="EAL85663.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003906"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="HOGENOM:HBG056247"
FT                   /db_xref="HOGENOM:HBG327866"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniParc:UPI000051FB4E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD75"
FT                   /transl_table=1
FT                   /translation="MTRRVTRSAAAREAALFAAKAQDVKPQLTDSNGPDVSPKTGKSTP
FT                   GRKRKLPIEHPEKLSKSSKTSKPKGSLPSLNVNDDLPHNLGSVSQPHESINVEPKLNKQ
FT                   DPGIEEEEDLDNLASDLQKTVDKATEGLPQQIKISKKKNPYGLTPGATPFPEWARPTPE
FT                   ECEEVNRLLSSAHGEVIPPSKIPEPSLTVTGCGEVPSVLDALIRTLLSGATTGRNSALA
FT                   FGGLVQRFGILEEGIGKGSVNWDAVRQAPLKDVFEAIKRGGLAEIKSRKIKAILDMVYQ
FT                   ENQERKEFLVKGESDGSSDLMPGEKEYEIACADQNFLSLNHLHTLSTEDAMTELVKYPG
FT                   IGPKTAACVILFCLQRPCFAVDTHIFRICKWLGWVPPGKATEVTAFSHLEVRIPDYLKY
FT                   SLHQLLIRHGKTCPRCRAITGQSSAGWEDGCVIDHLVTRTGKKKEGNTNVPVASKRRTG
FT                   RKIRAETDGSDE"
     atgactaggc gtgtcacacg ttccgcagca gcccgagagg cagctttgtt cgcggcaaag        60
     gcacaggacg tcaagccgca gctaaccgac tcgaacggtc cagacgtctc gccaaagact       120
     ggaaagtcta cacctggtcg gaagaggaaa ctgcccatag agcatccaga aaaattatca       180
     aagtcatcca aaacgagcaa gccaaaaggc agtttgccaa gtctcaatgt gaatgacgac       240
     cttccacaca atctgggctc agtctctcaa ccacatgaga gtatcaatgt agaacctaaa       300
     ctcaacaagc aggatcccgg catcgaagaa gaagaagatt tagacaacct tgcaagtgat       360
     ctccaaaaga ccgtcgacaa agctacagag ggactaccgc aacaaatcaa aattagcaag       420
     aagaagaatc cttatggtct tacgcccgga gctaccccat ttcctgaatg ggctcggccc       480
     acacctgaag aatgtgagga agtgaatagg ctcctttcca gtgctcatgg agaagtcatc       540
     cctccttcta agatcccgga gccgtctctc acggtcacag ggtgtggtga ggttccttca       600
     gtgctagacg cactcattcg caccctgctc agcggtgcca cgacagggag gaattccgct       660
     ttggctttcg gtggcctggt acagaggttc ggtattcttg aagaaggtat cggcaaggga       720
     agtgtcaact gggatgccgt ccgtcaagca ccgctgaaag atgtcttcga ggcgatcaag       780
     aggggcggtc tggcggagat caagagcaga aagatcaagg caatactgga catggtttac       840
     caggagaacc aagagcgcaa agagtttctc gtgaaaggag agtcggacgg gtcctcggat       900
     ctcatgccag gagagaagga gtacgagata gcgtgcgcgg atcagaactt cctctcactg       960
     aaccacctcc atactctcag cacggaagat gccatgacag agctagtcaa gtacccgggt      1020
     atcggtccca aaacggctgc ctgtgtcatt cttttctgct tgcaacgccc atgctttgcg      1080
     gtcgataccc atattttccg tatctgcaag tggctaggct gggtgcctcc gggtaaagct      1140
     accgaggtca ctgctttcag tcatcttgag gttcgcattc cggattacct gaaatactct      1200
     ctgcaccaac ttttaattcg ccatggaaag acttgtccta gatgtcgagc gatcaccggg      1260
     cagtcctccg ctggctggga ggatgggtgt gtgatcgacc acctcgtaac tcgaactgga      1320
     aagaaaaaag agggaaacac gaatgtgcct gtggctagca agagaaggac tggacgaaag      1380
     attcgcgctg agactgatgg aagtgacgaa tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page