(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE26

ASFUM1_6.PE26        Location/Qualifiers
FT   CDS_pept        96107..97339
FT                   /codon_start=1
FT                   /gene_family="HOG000220029" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262214"
FT                   /orf_name="AFUA_6G00360"
FT                   /product="DUF453 domain protein"
FT                   /protein_id="EAL84229.2"
FT                   /db_xref="HOGENOM:HBG224006"
FT                   /db_xref="HOGENOM:HBG321890"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="UniParc:UPI0000F5187A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Z0"
FT                   /transl_table=1
FT                   /translation="MMVSRPLRWLLHPSPLRSQNVRVHRQFISSTAPFSKKQNSIPAAY
FT                   YRGGTSRAIFFRKEDLPSEQQQWDDIFRGTIGSPDPYGRQLDGMGGGISSLSKVCVVSK
FT                   SDRPDADVEYTFVSLGVKNMDVDYSSNCGNMISAVGPYAVDTGLFPVADDADVVSVRIF
FT                   NTNTGKIIRSTFPVVDGEAAAAGGFAIDGVASTGARIRLDFIDPAGSRTGKLLPTGKSV
FT                   DCFDDIPASCVDVGNPCVFVRASDLGVPGNLAPDKIDAHPTLLSQLDSIRRQAGVKMGL
FT                   AGTTKEVPGSVPKICLVSSPSDAYTSGMMQTPKDVDLVVRALSVGQPHKAVPITVALAL
FT                   ATAARVSGTVVADVVSDKPVDPAGITLGHASGKLLVGADFDPTGHVSCATVYRTARRIM
FT                   EGRVFWKGVST"
     atgatggtgt ctagacccct cagatggcta cttcatccct ctccactacg cagccagaat        60
     gtaagagtac atcgacaatt catatctagc acagctccat tttccaaaaa gcaaaacagc       120
     attccagcag catattaccg tggggggaca tcgcgtgcca tcttcttccg aaaagaggat       180
     ctaccgtcgg agcaacaaca gtgggatgac atcttccgtg gtaccatcgg aagtcccgat       240
     ccatatggac gccagctaga cgggatgggg ggcggcatct ccagtctgtc caaggtgtgc       300
     gtggtcagca aatccgaccg gccggatgct gatgttgagt acacctttgt ttcgctcggg       360
     gtgaagaaca tggatgtgga ttattccagc aactgtggga acatgattag tgcggttggg       420
     ccatatgcag tcgatactgg tctgttcccc gtggctgacg acgctgacgt tgtatctgtc       480
     cgaatattca ataccaacac gggaaagatc atccgatcga cgttccctgt agtggacggg       540
     gaggcggcag cagctggagg ttttgctatc gatggcgtgg ccagtactgg cgctcgaata       600
     cgactcgatt tcattgaccc tgccggctca aggacgggca aattgctacc aactgggaag       660
     agtgtcgatt gctttgacga cattcccgca tcatgtgtcg atgtgggcaa tccatgtgtt       720
     ttcgtgcgtg cttctgactt gggggtacca ggaaatctgg cgccagataa gatcgatgcg       780
     catcctactc tactctcaca gttggattcg atccgtcggc aagctggggt gaagatggga       840
     ctggctggaa caacaaaaga agtgcctggg agtgttccca agatctgcct cgtttcatct       900
     ccgtcagatg cttatacatc gggaatgatg cagacgccaa aggatgtcga tctggtggtt       960
     cgcgctctct cagtcggcca gccgcataaa gccgttccca tcaccgtcgc tttggctctt      1020
     gcgacggccg ctagggtgtc cggcactgtt gtggccgacg tggtaagcga caaaccagta      1080
     gatcctgctg gcattactct aggccatgcc agtggcaaac tgctagtcgg cgcagacttt      1140
     gaccctaccg gtcatgtaag ctgtgcgacg gtctatcgaa ctgcgcgccg gattatggag      1200
     gggcgtgtct tttggaaagg tgtttctact tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page