(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE261

ASFUM1_6.PE261       Location/Qualifiers
FT   CDS_pept        complement(834400..835821)
FT                   /codon_start=1
FT                   /gene_family="HOG000201716" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264312"
FT                   /orf_name="AFUA_6G03780"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85661.1"
FT                   /db_xref="HOGENOM:HBG056245"
FT                   /db_xref="HOGENOM:HBG331376"
FT                   /db_xref="UniParc:UPI000051EF01"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD77"
FT                   /transl_table=1
FT                   /translation="MLTPIRVRGRRKKALAQNSNHAQGGKARPSGPKGGRPLMSREARL
FT                   DSSQARNNKRARLWAARPSKRRKTLSLLETLPVELIEKIFLYSLNVNLPRASPSLAAAV
FT                   SSERIYRMLILLGFWNDSASEAEDPDSAISRILRPLDYAPLQDDDRENLQTSVLRCRWC
FT                   TMPRLLMQLSDMTNLTIQRHWVNAGIEMTRDQQESLDRFLARENDTSTYEGTDKDGNHY
FT                   TLSITPFVSINIACQETDEQQTHKILSIKHFPEKLLLGASGEGFSDDHATHLEIMRVAC
FT                   GLSRSDHLETDVSVSRESLHQGVHIALVEHNTRALATLLKIDEYIFRSNAAVAGGLPYS
FT                   IPPEHFRTAVRVARNDPALFQTLLRASAESVPADDPEITEWAMNLGDPFGHWLLDLMLR
FT                   LPQQIETANANPAEGALFYLGRANGQIELARRYLQDVLNVDELPSWMEASDDLFRQWRV
FT                   ITTTTGRDRFVESQY"
     atgctgaccc ccattagggt ccgcggccgt agaaagaaag cccttgcaca gaactctaac        60
     catgcccaag gcggcaaggc aagaccaagc gggcccaagg gcggccgtcc cttgatgtcc       120
     cgtgaggcca gactcgactc gtctcaggcc aggaacaata agagagcccg cctgtgggcc       180
     gcaaggccat cgaagcgtcg caaaacattg tctttgcttg agactcttcc ggtggagttg       240
     atcgagaaga tcttcttgta ctcgttgaat gtcaatctac cccgtgcatc gccctcgctg       300
     gcggcggcgg tgtcgagtga gcgcatctat cgcatgttga tactgctcgg tttctggaat       360
     gattccgcat cagaagctga ggatcctgac tctgctatct cgaggatact gagaccgttg       420
     gactatgctc ctctgcagga tgatgaccgc gaaaatcttc agacgtccgt cctgcgctgc       480
     cggtggtgca cgatgccccg gttgctcatg cagttgtcgg acatgacaaa cctaactatc       540
     cagagacatt gggtcaacgc tggtattgaa atgactagag accaacaaga atccttagac       600
     cggttcctcg cacgagagaa cgacacttct acatacgaag gtaccgacaa agacggcaac       660
     cactacactc tatccatcac tcccttcgta tcaataaaca tcgcatgcca ggaaaccgac       720
     gagcaacaaa cccacaagat cctcagcatt aaacactttc cggagaagct cctccttggc       780
     gccagcggag agggcttcag cgacgaccac gcaacgcacc tcgagatcat gcgagtcgcc       840
     tgcgggctca gtcgctccga ccacctagag acagacgtct ctgtctcccg cgaatccctg       900
     caccaaggcg tccacattgc cctcgtggaa cacaacacga gagcactcgc caccctcctc       960
     aaaatagacg agtacatctt ccgcagcaac gcagccgtcg ccggcggctt gccatatagc      1020
     atcccacccg aacatttccg cacagctgtc cgagtcgcac ggaacgaccc cgctctgttc      1080
     caaacattgc ttcgagccag cgcggaatct gtcccggcgg atgatcccga gattacggag      1140
     tgggcgatga atctcgggga cccgtttggc cattggttgc tggatttaat gttaaggctt      1200
     ccgcagcaga tagagactgc gaatgcgaat ccggcagagg gtgcgctgtt ctatctgggg      1260
     agagcgaatg ggcagattga gctggcgaga cggtatttgc aggatgtatt gaatgtggac      1320
     gagctgccga gttggatgga ggcgtccgat gacctgttta ggcaatggag ggttatcaca      1380
     actacgacag gaagagacag gttcgtagag agccagtatt ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page