(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE262

ASFUM1_6.PE262       Location/Qualifiers
FT   CDS_pept        join(836798..836818,836874..837062)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264313"
FT                   /orf_name="AFUA_6G03790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85660.1"
FT                   /db_xref="HOGENOM:HBG056244"
FT                   /db_xref="UniParc:UPI0000520220"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD78"
FT                   /transl_table=1
FT                   /translation="MGAVVSCIQGVFRSIGACLMGIVNTIGAVLKAIINGVVSLCNIVI
FT                   SCLTCGYCGNRGRMRSSRHRRSRV"
     atgggtgcgg ttgtgtcttg catccagggc gtcttccggt ccatcggcgc ctgcctcatg        60
     ggcatcgtca ataccatcgg cgcggtcctt aaagccatca tcaacggtgt cgtcagtctc       120
     tgcaatatcg tcatttcatg cctcacttgt ggctactgcg gaaaccgggg aaggatgagg       180
     tcttcgagac atcgacgatc aagggtctaa                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page