(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE265

ASFUM1_6.PE265       Location/Qualifiers
FT   CDS_pept        join(complement(841093..841323),complement(840931..840989),
FT                   complement(840546..840870))
FT                   /codon_start=1
FT                   /gene_family="HOG000239674" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056386"
FT                   /gene_name="egd2"
FT                   /orf_name="AFUA_6G03820"
FT                   /product="Nascent polypeptide-associated complex subunit
FT                   alpha"
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85657.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG236848"
FT                   /db_xref="HOGENOM:HBG628290"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR016641"
FT                   /db_xref="UniParc:UPI000051EA66"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WD81"
FT                   /transl_table=1
FT                   /translation="MADPRVEELPDEEVPKANVEDAGSDSESEAGEESSIPAGAAVTIH
FT                   SRNEKKARKAIGKLGLKHVPGITRVTLRRPKNILFVINQPDVYRSPSSNTWIIFGEAKI
FT                   EDLNSQAQASAAQQLAAAEAAAGEHAGHDHDHDHGKGKAPETEAKKEEEEDDGEEVDET
FT                   GLEAKDIELVMAQANVSRKKAVKALRENDNDIVNSIMALSI"
     atggctgatc cccgtgttga agagctccct gacgaggagg ttcccaaggc caacgtcgag        60
     gatgctggca gcgactctga gtccgaggct ggtgaggagt ccagcatccc cgctggcgcc       120
     gccgtcacca tccactcccg taacgagaag aaggccagaa aggctattgg caagcttggc       180
     ctgaagcacg ttcccggcat cactcgtgtc accctccgca gacccaagaa catcctcttc       240
     gtcatcaacc agcccgatgt ctaccgctct ccctccagca acacctggat catcttcggt       300
     gaggccaaga tcgaggacct gaactcccag gctcaggcct ccgctgctca gcagctggct       360
     gctgctgagg ccgccgctgg cgagcacgcc ggtcacgacc acgaccacga ccacggcaag       420
     ggcaaggccc ccgagaccga ggccaagaag gaggaggaag aggatgatgg cgaggaggtc       480
     gatgagactg gcctcgaggc caaggacatt gagctcgtca tggctcaggc taatgtgtcg       540
     cgcaagaagg ccgtcaaggc cctgcgcgag aacgacaacg atatcgtcaa ctccatcatg       600
     gcgctcagca tataa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page