(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE266

ASFUM1_6.PE266       Location/Qualifiers
FT   CDS_pept        join(complement(842568..842693),complement(842184..842483))
FT                   /codon_start=1
FT                   /gene_family="HOG000201693" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264315"
FT                   /orf_name="AFUA_6G03830"
FT                   /product="Ribosomal protein L14"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL85656.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG166121"
FT                   /db_xref="HOGENOM:HBG499844"
FT                   /db_xref="InterPro:IPR002784"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniParc:UPI00003E614E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD82"
FT                   /transl_table=1
FT                   /translation="MADIDVKVAQWKLVEVGRVVLIRSGPYTGKLAAIVEIIDHKRVLV
FT                   DGPSTEENKIVPRHALPLAHATLTPFVIPKLPRAAGTGPVKKLWEKNEIDGKWAKSTIA
FT                   QKTERAERRKNLTDFERFKVLRLKKQVRSVCETMGEL"
     atggccgata tcgatgtcaa ggttgctcaa tggaagcttg ttgaggttgg ccgtgttgtg        60
     ctgatccgca gcggtcctta caccggcaag cttgctgcca ttgtcgagat catcgaccac       120
     aagcgtgtcc tggttgacgg tccttccacc gaggagaaca agatcgttcc ccgtcacgct       180
     cttcctctcg ctcacgccac tctcaccccc ttcgtcattc ccaaactccc ccgcgctgcc       240
     ggcactggcc ccgtcaagaa gctctgggag aagaacgaga tcgatggaaa gtgggctaag       300
     agcaccattg ctcagaagac tgagcgcgct gagcggagga agaaccttac cgacttcgag       360
     cgcttcaagg tcctcagact caagaagcag gtacgttcag tttgcgaaac tatgggagaa       420
     ttgtga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page