(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE268

ASFUM1_6.PE268       Location/Qualifiers
FT   CDS_pept        join(845529..845753,845805..846090,846149..847587)
FT                   /codon_start=1
FT                   /gene_family="HOG000201671" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903126"
FT                   /orf_name="AFUA_6G03850"
FT                   /product="Signal sequence receptor alpha subunit, putative "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="receptor activity"
FT                   /function="signal recognition particle binding "
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle receptor
FT                   complex"
FT                   /protein_id="EAL85654.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005047"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005785"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="HOGENOM:HBG235775"
FT                   /db_xref="HOGENOM:HBG562580"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007222"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="UniParc:UPI000051ECA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD84"
FT                   /transl_table=1
FT                   /translation="MLEAFEVLTTSGVVLWSKSYAPVGAHVVNSLINDVFIEEKVRAQN
FT                   QAASSAAPIYKKEKYTLKWKQVKDFNLIFVAVYQSLLHLGWIDKLLDNVSTIFIDLYKD
FT                   ELRSTRARIIEYPFDKYFDQQVRELEDNAGAPTSESLVVEINERKDPLVSSDNGGPPPP
FT                   PVPGLLKAQRPVAQGVATSDEGSPPQTPDLSRSSTPISGHLLTAKGGPAGRASRRARKA
FT                   ANASATASSGDESIRKGKTLKSGKKMRKWDADGFADEDDGKVLDYSAPADGEDAPAPVV
FT                   EAVAQESWGRRTGKGQFVLKDLGDEVHSILENADHEKTKSSSSTGFVGSGVNALGGFFR
FT                   NIVGGKVLTEADLEKPLKAMEDHLLKKNVAREAAVRLCQGVQRELVGKKTGNFQSVDAA
FT                   LRSAMESSLRKILTPTSSLDLLREIDAVRSPTSKGQAPRPYVISIVGVNGVGKSTNLGK
FT                   ICYFLLQNNYRVLIAACDTFRSGAVEQLRVHARNLKELSTRENAGEVELYEKGYGKDAA
FT                   NVAKDAVEYGAANHFDVVLIDTAGRRHNDQRLMSSLEKFAKFAKPDKIFMVGEALVGTD
FT                   SVMQARNFNQAFGTGRNLDGFIISKCDTVGDMVGTLVSMVHATGIPIVFLGVGQHYGDL
FT                   RGLSVPWAVNLLMK"
     atgttagaag ccttcgaagt cttgacaaca tctggggtgg tgctgtggtc gaagtcgtat        60
     gcgccggtcg gagcgcatgt tgtcaacagc ctaatcaacg atgtcttcat tgaggagaag       120
     gttcgagcgc agaatcaggc agcgagcagt gcagctccta tctacaagaa ggaaaagtat       180
     actctgaaat ggaagcaagt aaaggatttc aatctgatat ttgtggctgt atatcaatct       240
     ctgctacatc ttggttggat cgacaaactc ttggataatg tttcgaccat attcatcgac       300
     ttatataagg atgagctaag gagcacacgg gctaggatta ttgagtaccc attcgataag       360
     tacttcgacc agcaggtgcg agagcttgag gacaatgctg gggctcctac atcagaatct       420
     ctcgtagtag agatcaacga gagaaaggac cctcttgtct catcagataa cggcgggcca       480
     cctccgccac ccgtgcctgg tctgctgaaa gcgcaacgtc cagttgcgca gggcgtggcg       540
     acctcggacg agggttcgcc accccaaacc ccagatcttt ctcgatcgtc aacgcccatt       600
     tcaggtcatc tattgaccgc gaaaggaggg cctgctggcc gcgcctctcg tcgcgcacgc       660
     aaagcggcca acgcgagcgc taccgcttct tctggagatg aaagcattcg gaaggggaaa       720
     acattgaaaa gtggaaaaaa gatgcgcaag tgggatgctg atggctttgc ggatgaggac       780
     gacggcaagg tcctcgatta ctccgccccc gcagatggtg aggacgcacc ggctcctgta       840
     gtcgaggctg ttgcgcagga atcctgggga cgccgaacag gcaagggcca atttgtgctg       900
     aaagatctag gggatgaagt ccattccatt cttgagaatg ctgatcatga aaagacaaag       960
     tcttcctcgt ccacgggctt tgttgggtct ggagtcaacg cacttggtgg attcttccgt      1020
     aatattgtcg gcggcaaggt ccttactgag gctgacttgg agaaaccctt gaaagccatg      1080
     gaagaccatt tgctgaagaa gaacgttgcg cgcgaagcgg ccgtccgtct atgtcaaggc      1140
     gtccagcgcg aattagttgg caagaagaca ggcaactttc aaagtgttga tgcagcactg      1200
     cgctccgcaa tggagtcctc gttgcgcaaa atattgacgc caacgtcatc tctcgatcta      1260
     ctgcgtgaga tcgatgctgt tagatctccg acgagcaaag gacaggctcc tcgcccatat      1320
     gtcatttcca tcgtgggcgt gaacggtgtt gggaagtcga caaatctggg caaaatttgt      1380
     tacttccttc tccagaataa ctatcgtgtt ctgattgcag cctgtgacac cttccgctct      1440
     ggagccgtgg agcagttacg agtccatgct cgcaatttga aggaacttag tacccgggag      1500
     aatgctggag aggttgaact ctacgagaag ggatatggaa aggatgcagc gaatgtagcg      1560
     aaggatgcag tggagtacgg tgcggcgaat catttcgacg ttgtgttgat tgatactgcc      1620
     ggtcgccgtc ataacgacca acgccttatg tcttcgctcg agaagttcgc caagttcgcc      1680
     aaaccagata agatcttcat ggtcggtgaa gctctggtcg gtacggacag cgtgatgcag      1740
     gctcgcaact tcaaccaagc tttcggcact gggagaaacc tcgatgggtt catcatcagt      1800
     aaatgtgata ccgttggtga catggtaggt acgcttgtca gcatggtgca tgctacaggc      1860
     attcctattg tttttctggg tgtaggccag cactatggtg atttgagggg cctaagtgtt      1920
     ccttgggctg tcaatctgct gatgaagtga                                       1950
//

If you have problems or comments...

PBIL Back to PBIL home page