(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE271

ASFUM1_6.PE271       Location/Qualifiers
FT   CDS_pept        join(complement(854534..854711),complement(854322..854466),
FT                   complement(854189..854266),complement(854005..854019),
FT                   complement(853901..853933),complement(853633..853838),
FT                   complement(853472..853584))
FT                   /codon_start=1
FT                   /gene_family="HOG000217811" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903127"
FT                   /orf_name="AFUA_6G03880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85651.2"
FT                   /db_xref="HOGENOM:HBG056238"
FT                   /db_xref="UniParc:UPI0000F51CEE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD87"
FT                   /transl_table=1
FT                   /translation="MARADIDNRSPLQAEAKRNFENQIVLSPSSHNASVALGARTRVLR
FT                   ASDVLLSLAGKTEKETLGDEDSPGVESFAETVRLFPPLTNDDGAPNGAVDSKCPDCDAV
FT                   FSSPCELKQHYLTRFCPGAAVAIYLMMRDRGSTTSCKSCGEECNISYEPVLNDPRDDIN
FT                   LRDIQKDRVNGAHSRSPSIAQKNLTGSKFHIATNTAGEQSFAQRARKLRDSWSLRKISQ
FT                   SDEDELIAVSFAGLYDLERGRSTLFSDSAVLKV"
     atggctagag ccgacattga caaccgcagt ccgctgcagg cagaggcgaa gcggaacttt        60
     gagaaccaaa tcgtcctaag cccttcttcg cacaatgcct ctgttgcact tggagcccgg       120
     acacgggttc ttcgagcgtc ggacgtctta ctgtcgttag ctggcaagac agagaaagaa       180
     accctcggag atgaagattc tccaggcgtt gaaagttttg cagaaactgt acgtctgttc       240
     ccgcctctca caaatgacga tggggccccc aatggtgctg tggactccaa atgcccggat       300
     tgcgatgctg tcttctcctc accgtgcgaa ttgaaacaac actacttgac gaggttctgt       360
     cctggtgcag ctgtggcaat ctatttgatg atgcgagatc gtggatcgac aacgagttgc       420
     aaaagctgcg gggaggagtg taatatctca tatgagcctg ttctgaatga ccccagagac       480
     gatatcaatc ttcgagatat tcaaaaggac agggtgaatg gagcgcacag cagaagccca       540
     agcattgcgc agaagaacct taccggctct aaattccata tcgcaactaa taccgccggg       600
     gagcagtcct ttgctcagag ggccagaaag ttgcgggatt cctggtcgtt gagaaaaatc       660
     tcgcaaagtg atgaagatga gcttatcgca gttagttttg ctggactgta tgacctggag       720
     agaggtaggt caaccctttt ctctgactcg gccgtgctga aggtgtga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page