(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE273

ASFUM1_6.PE273       Location/Qualifiers
FT   CDS_pept        join(complement(860621..862946),complement(859681..860560),
FT                   complement(859559..859578),complement(859391..859473))
FT                   /codon_start=1
FT                   /gene_family="HOG000201627" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264319"
FT                   /orf_name="AFUA_6G03900"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL85649.1"
FT                   /db_xref="HOGENOM:HBG056237"
FT                   /db_xref="HOGENOM:HBG327859"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000052092B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD89"
FT                   /transl_table=1
FT                   /translation="MLPSLKMSTTDPFGAPPSDSEHSITSISKCDPSPSQPSDGEWTDD
FT                   DDFAISPLSDRSPPRGNHWTRFFPELSSHFSLVSPISTTTPKVTPFSLLADMQAIDHQN
FT                   RQNSSDSGTRTDSPSLSEDTFDTTSSCYSRRSSVTSLGSELAGCPYKSADAFSVISPAA
FT                   AGVFDDDIAPMLVGPASKLAVESPSLDEVRNKPLPREPPIALAPLSVRHNGPRPFQACQ
FT                   RPSSDWPCTTNPASPATRLSHSQRTLSQAAQELENFLAGITEQRHNEPQLFSSQISNGP
FT                   LQISRGNMDMIATRPAPRPPTNIASVKSKDNSSQKISPEQPERDLQKPMKKTKYKGPFS
FT                   FSVPGFSRKYTNTHLRSFSSSSLKSEMESPSFRPQRPPRPETIHDEAEDTAEVAQSPFL
FT                   PVPSQRQRSSSFCSERELRLRLPRLQTKQVRSHEDLVSSSSSFVEAERVAERSMPSIRA
FT                   NNVEEKIFVASSKSGRSNTSDSLFELDGGMPQRMIYELDAGLPSPHPKINISVHKPSKT
FT                   TAVQLPDDIALKILEQVASLDDLFHLAVVSKQYYRVFKQHELHLMKTTVYRMSPPAWEL
FT                   REMSPPWDSEWQILVDPDAPVPEYTPTLYLQRYAQDIYTLAQLKSLILARCNTFLRQET
FT                   INGLTGKDDTRAAEIDDAFWRIWTFCRIFGCGKNRENDIVGQMDWLNGGVMAHDRNSIM
FT                   TTSLTEPFGMNNVLFEPPEGFGRGNGEGLSQSQLYDMTEIWTCLAVLLQPIHGRRTEAR
FT                   KAGVFAGLDIAENDTAKEEAMIEEWTYYVLTLGPSAVLSIGSICAFDDSEATFQTAQSI
FT                   GLTKWEPADSSISRSTFLKEAVSRAYKVREGSPSLPGSRLSNASSTSSRSSAGRKTTSQ
FT                   ASSNTSDSNQINRRRQAVFAAQLRNRRTQQQNNPGNPITFAEERPISSYAMIMSRLEGL
FT                   PSNQPLPPAPPRQQVASSASLTPRYYPPAPIQYSQPLLPPPPPPTANPVAYRPQVLDPV
FT                   DQAIHVMVHELGFKEEDVKWALKITDTGEGIDANAAVALLTREQERYEQRRSGRFAFRS
FT                   KSPSLLESVINSQESVNSGWRPIMILPAPVFACRFDTHYAHSLQDIYCPDTFQI"
     atgctaccat ctttaaaaat gagcacgact gacccgtttg gcgcgccacc gtccgattca        60
     gaacactcca ttacatcgat ctcaaagtgc gatccgtcgc caagtcaacc atctgatggc       120
     gaatggacgg atgacgacga tttcgcaatc tcaccactgt cagacagatc gcctccaaga       180
     gggaatcatt ggactcgatt cttccctgaa ctgtcgtcgc atttctcgct ggtgtctcca       240
     ataagcacta caactcccaa ggtgacacct ttttctcttc tggcagacat gcaggcgatt       300
     gatcatcaaa accgacagaa ctcctcggat tctggcactc gaacagattc tccgtccttg       360
     tctgaagaca ctttcgacac aacttcctcg tgctacagcc gaaggtcgtc cgtgacaagt       420
     cttggctccg aactagccgg gtgcccctac aaatcagccg atgccttttc ggtcatttcc       480
     cccgctgctg caggagtttt tgatgacgat atagcgccca tgctagtagg cccggcctct       540
     aagctagccg tagaaagtcc atcactggat gaagtgagaa acaagcccct ccctcgggag       600
     cccccgattg cattagctcc cttgtcagtt cgtcacaacg gcccccgtcc gttccaggct       660
     tgccagcgcc cctccagcga ctggccttgt acgacaaacc cggccagtcc tgccacacgg       720
     ctttcgcatt ctcagcgtac tctatcccag gcagctcagg aattggaaaa tttccttgca       780
     gggatcaccg agcagcgcca caatgagccc caattgtttt cttcacagat ctccaacggg       840
     cctttgcaaa taagtcgcgg aaacatggac atgattgcga ctcgaccagc tccaaggcct       900
     cctactaata ttgcttctgt caagtcaaaa gataactcga gtcaaaaaat tagtcccgaa       960
     caaccagaac gcgatttgca aaaaccaatg aagaaaacca agtataaagg gcccttctcg      1020
     ttttccgtcc ctggattcag tcgcaagtac accaatactc atctccgatc gttcagcagc      1080
     tccagcttga agtcagaaat ggaatccccg tcctttcgcc ctcagcgccc gccgcgcccg      1140
     gaaactattc acgatgaggc agaagatact gctgaagtgg cccagtctcc cttcttacca      1200
     gtaccctctc agagacagag atcatcgtcc ttttgcagcg aaagagaatt acgattgaga      1260
     ctccctcggc ttcagacaaa gcaagtgcgc agccacgaag acctcgtctc ctcctcatcc      1320
     agctttgtgg aagccgaacg ggtcgccgag cgatcgatgc ctagcattcg agcgaacaat      1380
     gtggaggaga agatctttgt cgcgtccagc aaatcaggac gatcaaacac ctcagactcg      1440
     cttttcgaat tggacggtgg catgccccaa agaatgatct atgagcttga tgcaggtttg      1500
     ccatcaccac atcccaaaat taacatctca gttcacaaac cctccaagac aactgccgtc      1560
     caattgccag atgacatcgc cctcaaaata ctggagcaag ttgcttccct tgatgatctc      1620
     ttccatctag ctgtcgtctc caagcagtac tatcgcgttt tcaaacagca tgaattacat      1680
     cttatgaaga ctactgtcta ccgcatgtcc cctccagcct gggaattgcg tgaaatgagc      1740
     cctccgtggg atagcgaatg gcagattctc gttgatccgg acgctcctgt ccccgaatac      1800
     actcccacac tttatctcca acgttacgct caagacatct atacactcgc tcagctcaag      1860
     tcactcatcc tggcccgctg caataccttc cttcgccagg aaacgataaa tggtctgaca      1920
     ggcaaagatg atacccgagc ggcagaaatc gatgacgcct tttggcgaat ctggactttc      1980
     tgccggatct ttggctgtgg caagaatcgg gagaatgata tagtaggaca gatggactgg      2040
     ctgaatggcg gcgttatggc ccacgaccgt aacagcatca tgaccacgtc gctcactgag      2100
     ccattcggta tgaacaatgt cctattcgaa ccgccggagg ggttcgggcg cgggaacggg      2160
     gaaggtcttt cccaaagtca gctctacgac atgacagaaa tatggacttg tcttgccgtg      2220
     ttgctccaac ccattcacgg caggcgcact gaggcccgaa aggctggcgt ttttgccggg      2280
     ctcgacatcg cagaaaatga cacggcgaag gaagaagcta tgatagagga atggacatac      2340
     tatgtcctca cgcttggacc ttcggcagtc cttagtattg gctcaatctg tgctttcgat      2400
     gactctgaag cgacattcca gacagcgcaa tccattggac tgacaaagtg ggagcctgcc      2460
     gactcctcta tcagccggtc cacttttctc aaagaagccg tatctagagc ctacaaggta      2520
     cgggaaggaa gcccgtcgct ccctggctca cgtctatcga atgccagttc tacctcttcc      2580
     agatcttctg ccggccgcaa gacaacgtct caagcaagca gcaacacgag cgacagcaac      2640
     caaatcaacc gacgccgaca agctgtcttc gcagctcagc tgcgaaaccg acgcactcag      2700
     cagcagaata accctggtaa cccgatcaca ttcgccgagg agcgcccgat ctctagctat      2760
     gccatgataa tgagtcgcct cgaggggctt ccaagcaacc aacctctacc tccagctcca      2820
     cccagacagc aagtggcatc gtcagcgtca ctgactcctc gctactaccc ccccgcaccc      2880
     atccagtact cacagccact acttccgcca ccaccaccac ccaccgcgaa cccggttgcc      2940
     tacagacctc aggtcctcga ccccgtcgac caggctatcc atgtgatggt ccacgagctc      3000
     ggcttcaaag aagaagatgt caagtgggcc ttgaagatca cggatactgg cgagggcatc      3060
     gatgcaaatg ccgcggttgc actgctcact agggaacaag aacgatacga gcaacggcgc      3120
     agcggccgct tcgcctttcg ctcgaagagc ccgtccctgc ttgaatccgt catcaacagt      3180
     caagagtcgg tcaactctgg ctggaggccc atcatgatac tgccggcacc tgtattcgca      3240
     tgtcgattcg atacccatta tgcgcattcg ttacaagaca tttattgtcc agacacgttc      3300
     caaatatag                                                              3309
//

If you have problems or comments...

PBIL Back to PBIL home page