(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE279

ASFUM1_6.PE279       Location/Qualifiers
FT   CDS_pept        join(879872..884795,884847..885421)
FT                   /codon_start=1
FT                   /gene_family="HOG000048639" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207680"
FT                   /gene_name="sec16"
FT                   /orf_name="AFUA_6G03960"
FT                   /product="COPII coat assembly protein sec16 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="EAL85643.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG056233"
FT                   /db_xref="HOGENOM:HBG327850"
FT                   /db_xref="UniParc:UPI000051FB4D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WD95"
FT                   /transl_table=1
FT                   /translation="MAQPEGVLAWNPAFRPEDNDSVATDLARLALDSGKEVSETTDVDT
FT                   HVSPPAEEFTDENGSIESKTAISADTSDQGAPDLVDSNTPAADNGSKPDTEEPDKPSRD
FT                   ESIFMQTDKSRAVEDVTENVPTENGNVDITSGLEEHVAEEPHYEGPEKSTGLAGRNDAQ
FT                   DLFEGNDTAWMDEAEGEVNGATVNGEASGTRPGFWDSLGDNERDNEDDFFNQLKTQTKP
FT                   IYSPPETEARFEEGIPLLGQGAAPQNNHAHKGESQVDDVFGDDEDDESGFFSEIQKRTS
FT                   AEGPPPITRKSTSQVIDSINAVSDSMFSKQLPAAAELNNSLAVPTADGEIKNSPSEEDL
FT                   AARWQAELSDDADETMPTEDDLAARWQAELDDDDDDLLLDDDTTNAQRPPEAANIDHMN
FT                   DTSMLQSPFGTPENLARPKVQPVSYTPHQPSTSDLLSGIPAQNTAAQPTNASMSSYFSA
FT                   QAPPNPVTTRAESFAERSKEGYKSPYDIPEDLARPRRAVANSRTVVAQPGTVPKPPPRS
FT                   SSIPAPPLKASTVSPAPLGTSSTAPTAPQKNFFEELPLPPPRPKSRPASSGRYTPNAPV
FT                   SAPSLPQSIPPPANQYSNVPGAPQSNIGPPDPPQLQQPERLDPYSNLLAPNVPSAPAVP
FT                   STASRYSPRPPGVQAGVKPPPSPRYSPAPPQSTNAVAAAPRNRYASQPASISGQGAALQ
FT                   FQPRTSSPLAYHEKIHYEDQGQSEERPQLQSTASPPPLNHSHPSEQPVSSENKGPSGVD
FT                   VLENVPPLSTRPQSPPKNPYAPSAYTNEFANRVAPVSTGPPIAGMTGVLNSSTEESPFV
FT                   PPRRSQTQSPSQTLSPRLSVPSLDPFQRPASVHGSTSPTRTVNPYAPAPVPTHNRAPSQ
FT                   VLEFIPPTDGQQLDSLERWKGAPIFKFGFGGAVISCFPKHIPRYSAGQAAPMIKSCPGE
FT                   VRISQLNDWLPAAEGIVQHPGPLKGKSKKKDLVAWLSSKIAAFENADIPDFDRLSPDAS
FT                   KLREEKTLLWKVIRVLVENDGVLEGSVEAQKSLRNLLFPNLQDSGPNQSLGDVFTPSAT
FT                   LQPLNAPSQPDAVDSRSVDLLRDTLVLGEREKAVWAAVDKRLWGHAMIIASRMDRSVWQ
FT                   QVVQEFVRREVRSATSRTESLAAFYEILAGNIEESIDELVPPSARAGLQMISKVDGHGP
FT                   AKNSLDGLDSWRETVGLVLSNRSPDDQRALVALGRLLLSYNRTEAAHICFILSRVAVFG
FT                   GLDDPQANIVLLGVDHQRLSSCAALYNDDSILLTEAYEFATSVLAGSSVSTLPHLLAFK
FT                   LIHAWSLAERGRKSEAQQYCDAIAAALKATTKPSGYHNQHLFFGVDELSARLRETTSDG
FT                   GSSWISRPSMEKVSGSMWAKFNSFVAGDDSDAASTGSVKAEEIGPFARVSGTPTISRSP
FT                   SVSDIYGSYPVAAAQPLPATGPSRYQPVSQYAPSASPEQLRGRSSMDSQRSASFGYPLG
FT                   QRRGSQEPSTPVDTNMFHGMPMYGSPPVAGYQSTPPQSSYMPLAPVAEDSASGAQQESF
FT                   SAHSQVSDNAPSHRSSTYAPEPFGHPFDTQAVSTTSQPDQGGYMPPTSSGAYEPPSFES
FT                   NTESADGAQDESTEEDKPKKKSIMDEDDDEDLAARAAAIQKAERARRDREADEAFRKAA
FT                   EADAKKPPPATGKKGWFSGWFGGKKDDNSGGGPIRAKLGEENSFYYDTELKKWVNKKDP
FT                   GSAAPTRGTPPPPKGSAPPSRSMSGSGGPPPAMATPPPTGASGSRPSSSAGAPTSVSAS
FT                   PAPPSLGAPPPAIPRSVSTGAVLPTPPSSSAGAPPRPATSLSNASSIDDLLGAPQARKG
FT                   PAARGKKKGRYVDVMAK"
     atggcgcagc cagaaggagt actcgcgtgg aatccagcat ttcgacctga ggataacgat        60
     tctgttgcga ccgatctggc caggttggcg ctggattccg ggaaagaagt gtcagaaacc       120
     acagacgttg acacccatgt gtctccccct gccgaagaat tcaccgacga gaatggttct       180
     attgagtcca aaaccgctat ctctgctgat accagtgacc aaggtgcgcc cgatttggtc       240
     gactcgaata cgcccgctgc cgataacggc tcgaaaccgg acactgaaga gcccgacaaa       300
     cccagccgtg acgagtcgat ttttatgcag actgataagt cccgagcagt cgaagatgtc       360
     acagagaacg tgcctacgga gaacggcaat gttgacataa caagtggact tgaagagcat       420
     gtagcagaag aaccacacta tgaggggccg gaaaaatcta ctggcttagc gggtcggaat       480
     gatgcacagg acttatttga gggcaatgat actgcctgga tggatgaagc tgagggcgaa       540
     gtgaatggcg caacagtcaa cggagaggct agcggtaccc gtccgggctt ctgggacagt       600
     ctcggggata acgaacggga taatgaggat gacttcttta accagctcaa aacgcaaaca       660
     aagccgatat atagtccgcc agagacagaa gctcggttcg aagagggaat tccgctacta       720
     ggtcaaggtg cagcaccaca aaataatcat gctcacaagg gggagagcca agtcgacgac       780
     gttttcgggg acgatgaaga tgacgagagc ggatttttta gtgaaatcca gaagcgaact       840
     tcagccgaag gacctccccc catcacgcgc aagagcacca gtcaagtcat cgattctatt       900
     aatgcggttt cggactccat gttcagtaaa caattgccag cagccgcgga gttgaacaac       960
     agtttggctg tgcccacagc agatggtgaa atcaaaaatt ctccctcaga agaagatctt      1020
     gccgcacgat ggcaggcgga actttctgat gatgctgacg aaactatgcc caccgaagat      1080
     gatctggctg cccggtggca ggcggaactc gatgatgatg atgacgactt gctcttggat      1140
     gatgatacga cgaatgcaca aagaccacca gaggctgcca atatagatca tatgaatgac      1200
     acttcaatgc ttcagagtcc attcggtacc ccggagaatc ttgcgcggcc caaagtgcaa      1260
     ccggtctcct atacaccgca ccagccctct acatcagatt tgctctcggg tattcctgcg      1320
     caaaatactg cggctcagcc caccaatgct tccatgtcaa gttacttttc agcacaggct      1380
     cctccgaacc ctgtgacgac tagggcagag agcttcgcag aacgttcgaa ggaaggttac      1440
     aagtcacctt atgacattcc agaggatctt gcccggcctc gtcgggccgt tgccaacagc      1500
     agaacagttg ttgcacagcc cggtaccgta ccgaagccgc ctccgcggag cagtagcata      1560
     cctgcacctc ctttgaaggc gtcaacagtt tctcctgcac cgcttggaac ctcatcgaca      1620
     gccccaacag cacctcagaa gaacttcttc gaagagcttc cactgccgcc tcctaggccc      1680
     aagtcgcggc ctgcgagctc tggaaggtat acacctaatg cccctgtgtc tgcgccgtca      1740
     ctaccgcagt cgattccccc tccagcgaat cagtattcga acgttccggg agctccccag      1800
     tccaatatcg gacccccaga tccaccccag ttgcagcagc cggaaaggtt ggacccatac      1860
     tcaaatctat tagcgcccaa tgtaccaagc gcaccagccg ttccaagcac tgcgtcgagg      1920
     tactcgccaa ggcctcccgg cgtgcaggct ggtgttaagc cccctccttc gcccagatac      1980
     tctccagccc cacctcagtc tacgaatgct gtggcagcgg ctcctcgcaa tcgctatgcc      2040
     tcacaaccag cgagtatctc agggcaggga gctgctttac aattccaacc acgcacatcg      2100
     agccctctgg cttaccatga gaagatacac tatgaagatc aaggccaaag tgaggagcgg      2160
     cctcaactgc aatcaacagc tagccctcct cctttgaacc attcgcaccc gtcagaacag      2220
     ccggtctcct cagaaaataa agggcctagc ggcgtggacg tcttggagaa tgtgcctccg      2280
     ttatctaccc gaccgcaatc gccacccaaa aatccatatg ctccttccgc atataccaat      2340
     gaatttgcca atcgcgtggc tcccgtgtct accggtccac ctatcgctgg aatgactgga      2400
     gtcctgaatt cttccactga ggaatccccg tttgtccctc ctcgtcgatc ccaaacacag      2460
     tctcccagtc agaccctcag tcccagattg tccgttccat cgcttgaccc tttccaacgg      2520
     cctgcttctg tgcatggttc gacgtctccg acgcgaacgg ttaatcctta cgccccagca      2580
     ccagttccca cccacaaccg tgcaccctct caagtgcttg agtttatccc tccaactgat      2640
     ggacaacaac tcgactctct ggaacggtgg aagggtgcac ccattttcaa gttcgggttt      2700
     ggtggcgctg tgatatcttg cttccccaag catatcccgc gttactcggc tggacaggca      2760
     gccccgatga tcaaatcttg tcctggtgag gtccgaatca gccagctgaa tgactggctt      2820
     cccgctgctg agggtattgt gcaacatcca ggtcctctga aaggcaagtc gaagaagaaa      2880
     gacctggttg cttggctttc tagcaaaatc gcagctttcg aaaacgccga tatccccgac      2940
     ttcgatcgtc tttcgccaga tgcttctaaa ctccgtgagg agaagaccct cttatggaag      3000
     gtcatccgag tcttggtcga gaatgacgga gttctggaag gctccgttga ggctcagaag      3060
     tctttgcgta acctactatt tcccaactta caggattctg gtccgaatca atcgcttgga      3120
     gatgttttta caccatctgc aactcttcaa cccttgaacg cgccctctca accggatgct      3180
     gtcgattctc ggtcggtaga tttactccgt gatactcttg tacttggaga aagagagaaa      3240
     gcagtctggg ctgcagtaga caaacgtctc tggggccatg ctatgataat agcctcgaga      3300
     atggatagat cagtctggca acaggttgtc caggagttcg tgaggcgaga agtgagatca      3360
     gcgacaagcc gcaccgagtc tctagcggcg ttctacgaga ttctagccgg aaatatcgag      3420
     gaaagcattg atgagctagt tcccccttca gccagggccg gcttgcaaat gatcagcaag      3480
     gttgacggac atggcccggc caagaattct cttgatggcc ttgatagctg gcgcgaaact      3540
     gtgggactag tactgagcaa ccgtagtcct gacgatcaac gagcgctggt tgctctcggc      3600
     cgactgcttc tctcatataa ccgtaccgag gccgctcata tttgtttcat tctttctcgc      3660
     gtcgctgtgt tcggcgggct cgatgaccca caagcaaata tcgtgcttct cggagtggat      3720
     catcaacgct tgtcgtcctg cgctgctctg tacaatgacg attctattct gctcactgag      3780
     gcctatgaat ttgcgacatc tgtgcttgcg ggctcgtccg tgtccacact tccgcatctg      3840
     ctggcgttca agctaattca cgcttggtcg cttgcggagc gtggtcgcaa gtctgaagct      3900
     caacagtact gcgacgccat cgcagccgct ctaaaggcaa ccacaaagcc gtccggctat      3960
     cacaatcagc acctgttctt cggtgtggat gagctatcgg cgcgccttag ggaaacgacc      4020
     agcgatggcg gatcatcctg gatttcaagg cccagtatgg agaaggtatc gggctcgatg      4080
     tgggcaaagt ttaatagctt tgttgctgga gatgacagcg atgcagcttc cactggttca      4140
     gtgaaggccg aagagatcgg accgtttgcc agagtctctg gaactcctac aattagtcgt      4200
     tcaccgtcag tatccgacat ctatgggtcc taccctgtgg cggcggctca gccattaccc      4260
     gccactggtc cctcccgcta ccaaccagtg agccagtatg ctccaagcgc ttcaccagag      4320
     caacttcgtg gtagatcgtc tatggactcc cagaggtcag catcgttcgg gtacccacta      4380
     ggacagcgac gaggatctca ggagccttct acaccggttg acacgaacat gtttcacgga      4440
     atgccaatgt atggctctcc accggttgct ggctaccagt ccacgcctcc acaatcatcc      4500
     tacatgcctt tggcacctgt tgctgaggac tcggcatctg gagctcaaca agaatctttc      4560
     tccgcacact ctcaggtctc cgacaatgcc ccgtcccacc ggtcttctac gtatgcaccg      4620
     gaaccatttg gtcatccttt cgatacccaa gctgtgtcta cgacgtctca accagatcag      4680
     ggcggatata tgcctcctac cagcagcggg gcctacgaac ctccatcctt tgagtctaat      4740
     acagagtctg cggacggtgc tcaggatgag tctactgagg aggacaagcc gaagaagaaa      4800
     tcaattatgg acgaggacga cgacgaggat cttgcagcgc gtgcagctgc cattcagaag      4860
     gcagagaggg cacgccggga ccgcgaagct gacgaggcgt tccgcaaagc ggccgaagca      4920
     gatgccaaga aacccccgcc cgcaacaggg aagaagggat ggttcagtgg atggttcgga      4980
     ggcaagaaag acgacaatag cggcggtggg ccaatccgtg ccaaacttgg ggaggagaat      5040
     tcattctact atgacactga actcaagaag tgggttaaca aaaaggatcc cgggagtgct      5100
     gctccaacac gtggaacgcc acccccaccg aagggttcgg cacctcccag tagatcaatg      5160
     agcggcagtg gtgggccacc acctgcaatg gcgacacctc cgccgacagg ggcctcggga      5220
     agccggccat cctcttctgc aggcgcacct acgtctgtgt ctgctagccc agctcccccc      5280
     tcgctcggag ctccgccccc tgctatccca cgatctgtgt caacaggcgc agtcttgccg      5340
     actcccccga gcagttcagc cggggcacca cccaggcccg caacgtcatt gagcaatgcc      5400
     agctcaatag acgacttact cggagcaccg caggcgcgta aaggccctgc agccaggggg      5460
     aagaagaaag gccgctatgt cgacgttatg gcgaagtaa                             5499
//

If you have problems or comments...

PBIL Back to PBIL home page