(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE280

ASFUM1_6.PE280       Location/Qualifiers
FT   CDS_pept        join(complement(887111..887153),complement(886931..886995),
FT                   complement(886126..886873),complement(885976..886052),
FT                   complement(885469..885657))
FT                   /codon_start=1
FT                   /gene_family="HOG000201572" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264321"
FT                   /orf_name="AFUA_6G03970"
FT                   /product="Cell cycle checkpoint protein (Hus1), putative "
FT                   /protein_id="EAL85642.1"
FT                   /db_xref="HOGENOM:HBG117679"
FT                   /db_xref="HOGENOM:HBG327851"
FT                   /db_xref="InterPro:IPR007150"
FT                   /db_xref="InterPro:IPR016580"
FT                   /db_xref="UniParc:UPI0000520211"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD96"
FT                   /transl_table=1
FT                   /translation="MRFRSQLTNIVTFTNGIVRFTIIPDQGTQVWAQLPVDAIFDEPTY
FT                   TLQSNSGVINLEVPIGALHRALRSATGATSAQLRLTKKGNIPLLALTILSSSWTTGSNA
FT                   VGITNLVSGTAAAGVTGPRERETVITQEIPVKVLHESAVEGLHEPRCRDPDVHIILPSL
FT                   AHLKSISERFSKLAGDARPAASGGIVSSTLTSPKLELSANMHGSLRLAIATDALRISSV
FT                   WSDLVNPPLDPAGMSQREIEQLPSERMRALGSDDEAGWAKVRIDAKDWSRVLSIGRLSP
FT                   KVVACFIHETALILYVYLPQSWNGEDSCLTEVVQRNCVRQTYMQTCKEKSCKAPPKQAA
FT                   IIQAEPGMQASKQTQHQWLYDRTEYMHITLCKK"
     atgcgttttc gaagccaact gactaacatt gtcaccttca ccaatggcat cgtccgcttt        60
     accatcatcc ccgaccaagg cacgcaagtg tgggcccagt taccagtcga cgccatcttc       120
     gacgaaccaa cttacaccct ccaatccaac tcaggtgtca tcaatctcga agtgccaatc       180
     ggcgcgctcc atcgcgccct ccgctccgca acgggcgcca cctccgccca actccgcctc       240
     acaaagaaag gcaacatccc cctcctcgca ctaaccatcc tctcctcctc ctggacaaca       300
     ggctcaaacg ccgtcgggat taccaacctg gtcagtggaa ccgctgctgc aggcgtgacc       360
     gggccccgcg agcgcgaaac ggtaatcact caagaaatcc ccgtcaaggt cctccacgaa       420
     agcgcagtcg aaggcctcca cgagccgcgc tgccgcgatc cagacgtgca catcatcctc       480
     ccgagcctgg cacacctgaa aagcatctcg gagcggttct cgaagctagc gggggacgcg       540
     cgacccgctg ccagcggcgg gattgtgtcc tcgacgctga cgtcgcccaa gctcgagtta       600
     tcagcaaata tgcatggctc gttgaggctg gcgattgcga ccgatgcgct gcgcatctct       660
     agtgtgtgga gtgatctcgt gaacccgccg ctggatccgg cggggatgtc gcagcgtgag       720
     attgagcagt tgcccagtga aaggatgcgg gcgctgggga gtgatgacga ggcggggtgg       780
     gctaaggtgc ggatcgatgc taaggattgg agtcgggtgt tgagtattgg gcggctgagc       840
     ccgaaggtgg ttgcctgttt tatccatgag acggccctga ttctgtatgt ttacttaccg       900
     caaagctgga atggggagga ttcgtgcttg acagaggtcg tgcagcgcaa ctgtgtgcgc       960
     cagacgtata tgcaaacatg caaggagaaa tcttgcaaag cgccgccaaa acaggccgct      1020
     attattcaag ccgaacccgg catgcaagct tctaagcaaa ctcaacatca atggctctat      1080
     gaccggaccg agtatatgca tatcacattg tgcaagaagt ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page