(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE282

ASFUM1_6.PE282       Location/Qualifiers
FT   CDS_pept        890356..894840
FT                   /codon_start=1
FT                   /gene_family="HOG000201583" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056389"
FT                   /orf_name="AFUA_6G03990"
FT                   /product="GAS2 domain protein"
FT                   /biological_process="cell cycle arrest"
FT                   /protein_id="EAL85640.1"
FT                   /db_xref="GO:0007050"
FT                   /db_xref="HOGENOM:HBG056231"
FT                   /db_xref="InterPro:IPR003108"
FT                   /db_xref="UniParc:UPI000051F8D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD98"
FT                   /transl_table=1
FT                   /translation="MATSRVSPVRPSVRFSPTESHHYRKRSLSRSPDRSAAPKYETIDP
FT                   LLSNLSPESTLLALTSTDAVPKNEKAAHDILWKSISQVSPAERALGIRAAIAAQRLGEW
FT                   YREVQAWDWPKRADAELGKGFMPPSSSNVNSEEQGYYGSLPSVVVKQHEDRIEEIRDGM
FT                   ETLDVDELKEHVLNAHIPARSRPSSSNSTVSVPPPLTYVQLSDFTAVITATILRALPLL
FT                   SRLNNLLTTWDVRLLVLRQIPGLLRALHLAQSEVDSAMDLLKATAPPSENDPLYSRENY
FT                   HAKRTSLEAIVLSAGRRMDIVLDALEGREDSLPESWIDELEAVESDFSTWVMEAEKRTV
FT                   ENEWLRMRSTTSESKEAQRVQNKQNRLSNIPEEEDSKFPVADSSDPSPQSSCSLPMETI
FT                   NEGDGDQLLVEAISDAVTHNQNSAQGLNALDPSQSHLDSSEFVSLSGPDTKISNEPSEQ
FT                   STIEIAIDAVLPVDVDMPRPESSEIVKSFSEDSSDDSIGGSSDKPSNDRPSQSTPSVCQ
FT                   IRPAVSEAASEEVSLEELVAAATQRHGNTTVLQIPEQGRSTSIEQSSGEMTDDTSSSKK
FT                   HQAPRDLQCSLPIDHFVANRPGAECLSVSSELVPENTYLVSHVEEKLCSSQLSASAQEV
FT                   SSIATRLADSSYKEHKVPLKEPSFATTKNDSFRIAESETPSLRTTGTSMEQTDAVCGIN
FT                   ENQTSSTTAGDNSQEERKQFSDGLSAVATPSDSGRQLSVEPLEDKVAPTVSSNLAEVAF
FT                   TEETSAAELLDRQGLNVDIGRAIDPFDSEKSSPIENEAATLASVIAEAATTRAPSTSTS
FT                   LKREESFSRSATSSPEPAKPVSNSRNDKASAVDPGEPQQSSETVPPPKIRLESPIKLSK
FT                   TRPQSLNISKGNSKSQARRTSTASAGSLSDYPSLTSSPGIREPRTASSNGTPLLLETPP
FT                   PFQDLSLASDYVSVGTDHTLREERLRRLDNQKVPNATVSHNRALSLPLQRFINERLDMQ
FT                   YESGAGGDLNGALGYRRASVASIDLRPQSEQHATDLQSSKDGSTVPTNNLKLLASQHME
FT                   LSQRRQSTSKLDDATPKPSKAWANNANAFARDSVIPSPSLESTVRNDTVRIRKQMITHP
FT                   SLENIGAYHSNVQPLRDTGFPRMETSRPSTPSKQMRRPKNQLDEKISSILDTIPARIHL
FT                   ISSEDHDFDEASVAPSLPVKHGERFRSMTPQGTLSRSGTPTPSLTLTAAPSRRRHSHAP
FT                   EDGSVKLYHLHRGGKAAPTKLFIRTVGEKGERVMVRVGGGWADLAEYLREYAIHHGCRA
FT                   VSETPRAEVQGPSSREPPARTSPGSTLTPTANTGRRTPSRPASVISNRPSSSLAVRKTR
FT                   RVSNVSDRPDLRSVSAGHAFVTSYSPLSTVSSRRRLSTSSTNSFGATSFASENHRATFA
FT                   NSPSIPLGLAGPKPRSRRVSISPESEAWVEDVLGQARRSSSSRPVKYVLPPNEQEPVSA
FT                   SARTLPKSRSISDIGRAGSSRRVALRGLGNPRD"
     atggcaacca gtcgtgtcag ccccgttcgc ccatcggttc gattctcccc caccgaatct        60
     catcattatc ggaaacgctc attatctcga tctcccgacc gttctgctgc tccgaaatat       120
     gaaacaattg accccttgct cagcaacctt tctcccgagt ccaccctgct ggcgctaacc       180
     tccaccgatg cggtaccaaa gaatgagaaa gctgctcatg atattctctg gaagagtatt       240
     tcacaagtct ccccggcgga acgcgccctg gggatccgcg cggctatagc agcccagagg       300
     ctgggcgagt ggtatcggga ggtgcaggca tgggactggc cgaagcgagc cgatgctgaa       360
     ttagggaaag gtttcatgcc gccatcttcg agtaatgtca actctgagga gcaaggctac       420
     tatggcagcc taccttcggt tgttgttaag cagcacgaag atcgcattga agagatccga       480
     gatggaatgg aaacattgga cgtggacgaa ctcaaagaac atgtactcaa cgcccacatt       540
     ccagcgcggt ctcggccctc gtcatcaaat agcaccgttt ctgtcccccc tcctctgacc       600
     tatgttcaac tgagcgattt cactgccgtc atcaccgcca ccattcttcg agcccttcct       660
     cttttgtccc ggttgaacaa cctccttacg acatgggacg ttcgactatt ggtccttcgc       720
     cagattccgg gcctactacg agctttgcat cttgctcagt ccgaggtgga ttctgcgatg       780
     gacctgttga aagctaccgc tcctccttcc gagaatgatc ctctttactc gagagaaaac       840
     tatcacgcca agcgaactag tcttgaggcg atagtactct cggcgggcag acgaatggat       900
     attgtccttg acgcgctcga gggccgagag gattcactcc cggaaagctg gattgacgag       960
     ctggaggctg ttgagtctga ttttagcacc tgggttatgg aagctgaaaa gcgtacggtt      1020
     gagaatgaat ggctacgcat gaggtcgacg accagcgaat cgaaagaggc ccaacgtgtg      1080
     cagaataaac agaaccggct gtcgaacatt cccgaagaag aagattctaa gtttccagtt      1140
     gcggattcat ccgacccatc cccgcaatcc agttgctcgc ttcctatgga aaccatcaac      1200
     gaaggtgacg gtgatcaatt gttggtggaa gctatttctg atgctgttac gcataatcaa      1260
     aactctgcac aggggctcaa tgctttagat ccctctcaat cccatcttga ctcgagtgag      1320
     tttgtgagtt tgtctggacc cgacacgaag atatcgaatg agccttcaga acaaagtaca      1380
     atcgaaatcg cgatagatgc tgtattacct gtcgatgtgg acatgcctcg accggagtct      1440
     tcggaaatcg tgaaaagctt ctcggaagac tcctccgatg attctattgg aggatcttca      1500
     gacaagccgt cgaatgaccg cccgtctcag tcgactccgt ccgtttgtca aattcgacct      1560
     gcggtgtctg aggccgcttc agaagaggta tcattggaag agcttgtagc ggctgcaact      1620
     caacgtcatg gaaatactac ggtgctacaa attcccgaac agggacgttc aacttccata      1680
     gaacaatcct ccggagaaat gacggacgac acaagctcaa gcaaaaagca tcaggcccct      1740
     cgtgaccttc aatgttccct gccaattgac cacttcgtcg caaaccggcc aggagctgaa      1800
     tgcttatctg tttcatcaga acttgtacca gagaatacat atcttgtctc acatgttgag      1860
     gagaagttat gcagttcgca attatctgca tctgctcagg aagtatcatc tatagctaca      1920
     aggttggcgg attcctctta caaagaacac aaagtaccgc taaaagaacc cagctttgcc      1980
     actacaaaga acgattcctt ccggattgcg gagtctgaaa caccctcact acgtacgact      2040
     ggcacatcga tggaacagac tgatgctgtt tgtggcatca atgagaatca gacaagcagc      2100
     acaacagccg gagacaacag tcaggaagaa aggaaacaat tttcagacgg attatccgcc      2160
     gtcgcgacgc cttctgactc tggtcgtcag ctttcagtcg aaccattgga ggacaaagtt      2220
     gctcccacgg tctcgagcaa cttggcagaa gttgcattca ccgaggaaac atctgcggct      2280
     gaactgctcg accgtcaggg cctgaatgta gatataggac gagcaattga cccgtttgat      2340
     tctgagaaat cctcgccaat tgaaaatgaa gcagcaactc tggcaagcgt catagccgaa      2400
     gcagctacaa ctagagcgcc ttctacttct acgtcactca agagagaaga gtcgttttct      2460
     agatccgcaa cttcgtcgcc agaacctgca aagcctgtgt ctaattctcg caatgacaag      2520
     gcgtctgctg tcgacccagg cgaaccacaa caatcttcgg agacagttcc tccacccaag      2580
     attcgcttgg aaagtcccat caaactatcg aaaaccaggc cgcagagctt aaatattagt      2640
     aaaggaaact cgaaatcgca ggctcgacga acttctaccg catctgcggg ctccctttcg      2700
     gattatccct cccttacatc tagtccaggc atccgtgaac ctcgcaccgc gtcttcgaat      2760
     gggacaccgc tgcttctcga aacaccacca cccttccaag atctttcact agcatctgat      2820
     tatgtgtcag ttggtaccga ccatactctg cgtgaggagc gcttgcgccg tttggacaac      2880
     cagaaggtcc ctaatgcaac cgtgtcgcat aaccgggccc taagccttcc cctgcaaaga      2940
     ttcatcaatg aaagacttga catgcagtac gagagcgggg ctgggggtga tttgaacggt      3000
     gccctcggct atcgacgagc ctcagttgct tccattgacc tgcgtcccca aagcgagcaa      3060
     catgcaacgg acttacaatc atcaaaggat ggctcaaccg tgccgactaa caatctgaaa      3120
     ctccttgcaa gtcagcacat ggaactttct cagaggagac aatccacttc gaaactcgat      3180
     gacgctaccc ctaagccgtc taaagcctgg gcaaataatg cgaacgcttt tgccagagac      3240
     tccgtcattc caagtccttc gttggaatct actgttcgta acgacaccgt tcgtatacga      3300
     aagcaaatga tcacccatcc tagccttgag aacattggtg cataccattc caacgtgcaa      3360
     cctttgagag atactggctt tccaagaatg gaaacatcga gaccctcgac tcccagtaaa      3420
     cagatgagga ggccgaagaa tcaactggac gagaaaatca gctcgatact ggacactatt      3480
     cctgcccgca ttcacctgat atcttctgag gaccacgact ttgacgaggc ttctgtggcc      3540
     ccttccctgc cggtgaaaca tggtgaacgg ttccgctcga tgacaccaca gggaacctta      3600
     tcgcgcagcg gcacccctac accttcattg acgctaactg cggctccgtc tcgcagaagg      3660
     cattctcatg cgccggaaga cggctccgtg aagttgtatc atttgcatcg aggtggtaag      3720
     gctgctccta ccaagctatt catccgcacc gtgggagaaa agggtgaacg ggtgatggtt      3780
     cgtgttggag gcggatgggc ggacttagcc gaatatctca gggagtacgc tatccaccac      3840
     ggttgtcggg ctgtatcaga aacaccgcgc gccgaggttc aaggccccag ttcccgcgaa      3900
     cccccggccc gtacatcacc aggcagcaca ctcacaccga ctgccaacac tggacgcagg      3960
     acaccgtccc gacctgcatc cgttataagt aatcggccct catcttcgct tgcggtccga      4020
     aagacacggc gagtgtctaa cgtgtcagat cggccggact tgcgttccgt tagtgccggt      4080
     catgcatttg tgacctcgta ttccccattg tccactgtct cctcgcgtcg acggctttcc      4140
     acgtcatcga cgaactcttt cggtgccaca tcattcgcaa gtgaaaatca tcgtgcaacc      4200
     ttcgcgaatt cgccgtcgat acccctaggt ctagcaggcc caaaaccgag atcacgtcgt      4260
     gtctcaatca gccccgagag cgaggcctgg gtggaagatg tactgggaca agctcgaagg      4320
     agctcttcct cgagaccagt caaatatgtc ttaccaccga atgagcaaga gcctgttagc      4380
     gccagcgccc ggaccttgcc caaatccaga agcatcagcg acatcggccg agctggttcc      4440
     agtaggcgag ttgcacttcg cgggttggga aacccgagag actga                      4485
//

If you have problems or comments...

PBIL Back to PBIL home page