(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE284

ASFUM1_6.PE284       Location/Qualifiers
FT   CDS_pept        join(901498..901567,901635..901945,902004..902174,
FT                   902257..903581,903635..904084,904141..904320,9
FT                   04378..904822)
FT                   /codon_start=1
FT                   /gene_family="HOG000201317" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903128"
FT                   /orf_name="AFUA_6G04010"
FT                   /product="Chromosome segregation protein Cse1, putative "
FT                   /function="importin-alpha export receptor activity "
FT                   /biological_process="cell proliferation"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85638.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008262"
FT                   /db_xref="GO:0008283"
FT                   /db_xref="HOGENOM:HBG022680"
FT                   /db_xref="HOGENOM:HBG327833"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR005043"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013713"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051FDAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA0"
FT                   /transl_table=1
FT                   /translation="MAADLGAVAQLLEASLDPRQNKQAEATLRQEEQKPGFSLQLLQIT
FT                   ASTSYPYNTRLASALCFKNFIKRNWTDEDGNYKLQLDEVATIKRELISLMISVPAGIQS
FT                   QLGEAVSVIADSDFWERWDTLVDDLVSRLQPKNPAANIGVLQVAHSIFKRWRPLFQSNE
FT                   LYTEINHVLNKFGNPFLALFEGLDSFLEENRSNKENLIQGFTQFNLMVKLLFDLSCHDL
FT                   PPMFEENLSGIASLLLKYLTYDNALLHTDDDTEAGQLEFVRAGIFEALTLYVQKYMDVF
FT                   SSHVGQFVQSSWSFLTTIGQETKYDILVSKALQFLTSVAGMPEHASVFQAEETLGQIVE
FT                   KVVLPNVSLRESDEELFEDEPIEFIRRDLEGSDSETRRRAATDFLRRLAEQFEGPVTKV
FT                   VLRYSDHYLAEYSKSPATNWKAKDTAVYLFSAIAAKGVATASHGVTATNPLVSITDFFQ
FT                   KNLAADLVVDESAHPILKVDAIKYLYLFRSIITKDQWQEVLPLLVKHLGSPNFVVYTYA
FT                   AIAVERVLYLADSQGQPIIAPATVTPLAKDLLQHIFSLIQKDPAPEKVQENEFLMRCAM
FT                   RVLIVIKEDVVPYTDIVLQHLINITDVISKNPSNPRFYYFHFEAMGAFIRFAAPANPEK
FT                   LEQALYPPFANILQGDVQGIVQSERNRGLGTSLSANVCAEFMPYVFQLFAALLEANPSG
FT                   SLPNYYQNLIAPMLMPVMWESKGNIPALVRLLSSIIPRGSQFILENQQLVPILGIFQKL
FT                   LSTKANEGFGFDLLESVVENFPPTALEQYFVSIMQVILTRLQNSKTEHLTLRFVRFYHF
FT                   ISAHDDKGYSADYFIQVTDKVQADLFTPIYLNIILPETQKLARPLDRKTAVLSFTKTLA
FT                   NSEAFANRYKKGWAFTCEALLKLLELAPLPASKDDIIAEHDVEDMAFGVGFTALNTVRP
FT                   QPRDPWPDTGADLKAWVGRYLKEADKKHNGRVSACVQERLGAEARTVLSSYIA"
     atggctgcgg atcttggagc tgttgcccag ctccttgaag caagcttgga cccaaggcaa        60
     aacaaacaag ctgaggctac tcttcgccag gaggaacaga aacccggctt ttctttgcag       120
     ctcctccaga tcacggcatc tacttcctac ccctacaaca cccgcctcgc cagtgcttta       180
     tgcttcaaga actttattaa gcgaaactgg actgatgagg atggcaacta caaacttcag       240
     ctggacgagg ttgcgacaat caagcgggag ctgatcagct tgatgatttc tgttccggca       300
     ggtatccagt ctcagttagg tgaagctgtc agtgtgattg cagatagtga cttctgggag       360
     cgatgggaca cccttgtgga tgatcttgtt tcaagacttc agccaaagaa cccggccgcc       420
     aatatcgggg tactacaagt cgcacattca atcttcaaaa gatggagacc attgttccag       480
     tcaaatgagc tgtatacaga gatcaatcac gttctgaaca aattcggaaa cccatttcta       540
     gctctcttcg agggcttgga ttcattcctc gaggaaaatc ggtcgaacaa agaaaatctc       600
     atccaggggt ttacgcaatt caatctgatg gtgaaattgc tgttcgacct ctcttgtcat       660
     gatcttcctc ctatgtttga agaaaacctc tcagggatag cttcgctctt gcttaaatat       720
     ttgacatatg acaacgcctt gcttcacaca gacgacgaca ctgaggccgg ccaattagaa       780
     ttcgtgcggg ctgggatttt cgaggccctg acgctgtatg tgcagaagta catggacgta       840
     ttcagctccc atgtcggtca atttgtgcag agctcgtgga gcttcctgac gacgattggc       900
     caagaaacaa aatatgatat tctggtcagc aaagcgcttc aatttttgac ttcagttgcg       960
     ggtatgccag aacatgcctc ggtcttccag gcagaagaga cccttggcca aatcgttgag      1020
     aaagtggtcc taccaaacgt gagtctgcgt gaatcagatg aggagctttt cgaagatgag      1080
     cctattgaat ttatccggcg ggatcttgaa ggatcggata gcgaaacaag acggcgggct      1140
     gccacagact tcttgagacg gctggcagag caattcgagg ggccagttac taaggtcgtt      1200
     ctcagataca gcgaccacta tctcgctgaa tattcgaaga gccccgccac gaattggaag      1260
     gccaaggaca ctgcggttta tctgttctct gcaattgcgg ccaagggagt tgccacagca      1320
     agtcacggtg tcactgccac aaatcccctt gtcagcatca ccgacttctt ccaaaagaac      1380
     ctcgctgcgg acctggttgt cgatgaaagt gcacacccta tcctcaaggt ggatgcaatc      1440
     aagtaccttt acctcttccg cagtatcatc acgaaagacc agtggcaaga agttcttcct      1500
     ttgctggtta agcatctcgg ttctccgaac tttgttgtct atacttatgc agctatcgct      1560
     gtcgaaagag tgctttacct tgcagacagc caaggtcaac cgattatcgc tcccgccact      1620
     gtcactcctc tagcgaaaga tcttttgcag cacatttttt cattgatcca gaaggaccct      1680
     gcccctgaga aggtgcagga gaatgaattt ttgatgagat gtgctatgag agtcctgatt      1740
     gtcatcaaag aagacgtggt cccatataca gacattgttc ttcaacatct cattaacatc      1800
     actgatgtca tcagcaagaa tccaagcaac ccccgcttct attatttcca ctttgaagct      1860
     atgggcgcat ttattagatt cgctgcaccg gccaatcctg agaagctcga acaagcgctc      1920
     tacccacctt tcgcgaatat ccttcaaggc gacgttcaag gtattgtgca atcagaaagg      1980
     aacagggggt tagggacaag tttgagtgct aatgtttgtg cagaattcat gccatacgtc      2040
     ttccagctct ttgcggctct tttggaagcc aacccttcgg gatcccttcc caactactac      2100
     cagaacctga tcgctcccat gcttatgcct gttatgtggg agtcgaaagg caacattcct      2160
     gcccttgtcc gtctactttc ttctattatc cctcgtggtt ctcagttcat cttggaaaac      2220
     cagcaactgg tccctatcct tggtatcttc caaaaattgc tttccaccaa agccaatgaa      2280
     ggctttggat tcgacctttt ggagagtgtc gttgaaaact tcccacccac ggcactagag      2340
     cagtacttcg tttctatcat gcaggtcatc ctcacccgcc ttcaaaactc caagaccgag      2400
     catctcactc tcagatttgt ccgcttctat cacttcatct ccgctcatga cgacaagggc      2460
     tatagtgcgg actactttat ccaagttaca gataaagtcc aagcagacct tttcaccccc      2520
     atctatctca acatcattct ccctgaaaca cagaaactcg cacgtccatt ggatcgcaag      2580
     acagccgtgc tgtctttcac aaagaccctt gcgaactcag aagcgtttgc aaacagatac      2640
     aagaagggat gggccttcac atgtgaggct ttactgaagt tgttggagct tgcccctctt      2700
     cccgccagca aggatgacat cattgccgaa catgacgttg aggatatggc tttcggagtg      2760
     ggtttcacag cactgaacac cgtgcggcca caacccaggg acccatggcc cgacacgggc      2820
     gctgatctca aggcttgggt tggcagatac ctgaaggagg ccgacaagaa acataatgga      2880
     cgggtctctg cgtgcgtaca agagcgcctg ggagccgagg cgcggacagt gttgagcagc      2940
     tacattgcat ga                                                          2952
//

If you have problems or comments...

PBIL Back to PBIL home page