(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE288

ASFUM1_6.PE288       Location/Qualifiers
FT   CDS_pept        join(complement(912151..912278),complement(910959..912084))
FT                   /codon_start=1
FT                   /gene_family="HOG000231938" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903129"
FT                   /gene_name="cdc123"
FT                   /orf_name="AFUA_6G04050"
FT                   /product="Cell division cycle protein 123 "
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85634.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG189908"
FT                   /db_xref="HOGENOM:HBG609337"
FT                   /db_xref="InterPro:IPR009772"
FT                   /db_xref="UniParc:UPI000051FDA9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDA4"
FT                   /transl_table=1
FT                   /translation="MPLLDPNTQTLAESSAAQPQRLPFPPVTYSHILHCSYHQWQPRYR
FT                   TLTPKSRAIPLTPSFVSYLRANGIVLPPETTRPHGDDDIDTFSDDGADEESDPSVEWQE
FT                   IHSQIKSTISEFGGKVTPKLNWSAPKDAVWMSATNDLQCRTPNDIYLLLKSSDFITHDL
FT                   EHPFDGCVPDPDDSSEAPATQPDIPYYLVLRKYVNFNPSLEFRCFVRNRVLLCMCQRDQ
FT                   NHFDFLFSLRDTLRSRIQAFFDEKLKDTFPDPNFVFDVYIPEPHQRVWLIDINPWADRT
FT                   DPLLFSWLEILQMKDPIGIKEEDTDAPEESFVRLSLNGATPTVVEVNRDEDSESEKDVG
FT                   SADDGDDSPFLPEFRLVKRDDPEAYSFSTPQYSAHKLPKEVVDASLAGSGGMSEFLGKW
FT                   QDILAKQTQEDTDSDDGR"
     atgccgcttc tagacccgaa tacacagact ctggctgagt cttcggcggc gcagccgcag        60
     aggctgccct ttcccccagt cacttactct cacatccttc attgctctta tcatcaatgg       120
     caacctcgat accgcacact cacccctaaa tctcgtgcta tacctttgac accttcattc       180
     gtatcctacc tccgcgccaa cggaatcgtt ctaccgccag agaccacacg gccacatggc       240
     gatgatgaca tagacacatt ttccgacgat ggtgcggatg aggagtcaga tccatccgtt       300
     gaatggcaag agatccactc ccagatcaag tcaaccatct cagagtttgg cggcaaagtg       360
     acaccaaagc taaactggag tgcgccaaag gatgccgtat ggatgtcagc gacgaacgat       420
     cttcaatgcc gaacgccaaa tgatatatac ctcctcctga agagcagcga cttcatcaca       480
     cacgacttgg agcatccatt tgacggttgt gtgcccgatc cagacgattc gtccgaggca       540
     cctgccaccc agcccgatat cccttactac ctcgtcctcc gcaaatacgt caacttcaac       600
     ccctctcttg aatttcgttg ctttgtccgt aaccgcgtgc ttttgtgcat gtgccagcgt       660
     gaccagaatc attttgactt cctcttctcg ctgcgggata cccttcgatc acgcatccag       720
     gcattcttcg acgagaagct caaagacaca ttcccagacc ccaacttcgt ttttgacgtg       780
     tatatccccg agccgcacca gcgtgtgtgg cttatcgaca tcaacccttg ggcggacaga       840
     accgacccac ttttgttcag ctggctggaa atcctgcaga tgaaggaccc tatcggaatt       900
     aaggaagagg acacagatgc tcccgaggaa agctttgttc gactgtctct caacggagca       960
     acccccacag tggtggaggt aaacagagat gaggactccg aatcagaaaa agatgttgga      1020
     agcgcagacg atggggacga ctcgccgttc ctcccggaat tccgtctcgt gaaacgtgat      1080
     gacccagagg catattcttt tagtacgcct cagtactccg cgcacaagtt gcccaaagag      1140
     gttgttgatg cgtctcttgc tgggtcaggt ggcatgagtg agtttttggg taaatggcag      1200
     gacattctag ccaagcagac acaggaggat acggacagtg acgatggacg atag            1254
//

If you have problems or comments...

PBIL Back to PBIL home page