(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE293

ASFUM1_6.PE293       Location/Qualifiers
FT   CDS_pept        join(complement(927411..927432),complement(927299..927361),
FT                   complement(926202..927229),complement(925052..926146))
FT                   /codon_start=1
FT                   /gene_family="HOG000201384" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903130"
FT                   /orf_name="AFUA_6G04100"
FT                   /product="Mis6 domain protein"
FT                   /protein_id="EAL85629.2"
FT                   /db_xref="HOGENOM:HBG056222"
FT                   /db_xref="HOGENOM:HBG325049"
FT                   /db_xref="InterPro:IPR012485"
FT                   /db_xref="UniParc:UPI0000F51CDC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA9"
FT                   /transl_table=1
FT                   /translation="MSSDQQSSPSGIEPRPSSLQDALEHLEAVAYVPSKKRYTDAGQLA
FT                   KTIASHAYESGIAPSALERLIHILTRKNLLDQGTITTLIKNLYPIDRISSKVVTQVVCC
FT                   LGPSKNKPSPATQASLLRWLILVYEFCEDRSHLAKLYAVLFNHLDMISLRKPLCHLLSI
FT                   ITRRKHVKPFRIQALMELVNAAGAEEKELIGLLNVFKNYYPDIIVGDLGALRRRGLVFK
FT                   HPDPEWTSHAKLLQDRNMEQVQAAQSSSFQVVHRGAAKRGKMEVIVPVLQTSRVSSNRT
FT                   SLEELRSVDHLIGKLDRIELPNQIISAMADNIAQKYLFLVQPESARLRLDDWLSSFFDE
FT                   QLEHAQDEERGSSESLGYILSLIVDYVRYTKDIPAPVQSFLRQYLSSWNGRDNKEEVLS
FT                   LLEYLPVQDFDILRANFLTPLEAAILGSGPFTMTVILDLYSSLIRQWGVKLRSSPSVSA
FT                   ESRPLGHLITHAELLALSILESLSVASNTGNKEPRKPAALSVLEFYCVLANLFSYAPVN
FT                   GQIRLTIPLAPTVYTLVFTPILSSISIISSVLASYKMSFETSLTSEILQVPGSTNSLYP
FT                   TELVGQFNGYVMDVCNLVWRNRGLNGDDPNALGCLLPPATTSALTQYIRELNEASRDRK
FT                   REASFFFNLSSIFSLSYHVALCNMSAGCFADIEEENNITEGKPRLRKPVTQKALSALEK
FT                   DGGVKLTWQEYRVRMLDWLDATGSRGIGNLMRSTMKALRKD"
     atgtcgtccg atcaacaaag tagcccgtct ggcatagagc ccaggccaag tagcctgcag        60
     gatgcgcttg agcatctaga agcagttgct tatgtgcctt cgaagaagcg atacactgat       120
     gctggtcaac tggccaaaac aatcgcttcg cacgcttatg aaagcggcat cgccccatct       180
     gcacttgagc gattgatcca cattttgaca cgaaaaaatc tccttgatca agggacaatc       240
     actaccttga tcaaaaatct ctatccgatt gacaggatct cttccaaggt tgtcacgcag       300
     gtcgtctgtt gcctcggtcc cagcaagaac aagccgagtc cggctacgca ggcttccctg       360
     ctgcgatggc tcatcctcgt ctacgagttc tgcgaggaca ggtcgcacct cgctaaactt       420
     tatgcggtgc tgttcaatca ccttgatatg atcagtctcc gcaagccgtt atgccatttg       480
     ctttcaataa tcacaaggcg gaagcacgtc aagccattta ggatacaagc tcttatggag       540
     ctggtcaatg ctgcaggcgc ggaagaaaaa gagctcatcg gtttgctaaa cgtcttcaaa       600
     aattattatc cagacatcat tgtgggggac ctgggggctt tgagacggag aggcttggtt       660
     ttcaagcatc ccgaccccga gtggactagt cacgcaaagc ttcttcaaga cagaaatatg       720
     gagcaagtac aagcggcaca atcatcaagt tttcaagtag ttcatcgtgg agcggcgaag       780
     agagggaaaa tggaagtgat cgttcctgtt ctccagacat cgagggtgtc atccaaccgt       840
     acctctttag aagagctgcg cagcgtcgac cacttgattg gaaagctcga ccgcattgaa       900
     cttccaaatc agataatatc cgcaatggca gacaacatag cccagaaata tttatttttg       960
     gttcaaccgg agtctgcaag gctccggtta gatgattggc tgagcagctt ttttgacgaa      1020
     cagttggagc atgctcaaga cgaagaacga ggctcgtcag aatctctagg ttacatctta      1080
     agtctcatcg tggattatgt gcgctataca aaggatattc ctgcgccagt ccagtctttt      1140
     ctcagacaat atctttcgtc ttggaacggc cgtgataaca aagaagaggt tctcagtctt      1200
     cttgagtacc tgcccgtcca ggactttgat attttacgag ccaacttcct gactcccttg      1260
     gaggctgcca tactgggcag tggtccattc actatgacag tcattcttga cctttattct      1320
     tcacttattc ggcaatgggg tgtgaagctg aggtcttcac cttcagtctc tgcagaatca      1380
     agaccgttgg gtcacctaat cactcatgcg gaactgctgg cattgtcaat actagagagt      1440
     ctttcggtgg cgtccaatac cggcaataag gaacctcgca aaccggccgc cctatctgtc      1500
     ctcgagttct actgcgtttt agccaaccta ttctcttatg cgcccgtgaa tggccagatc      1560
     cgtctcacta ttcctctagc tccgacagtc tacactctcg tttttacacc cattctctcc      1620
     agcatctcca tcatcagctc tgttcttgcc agctacaaaa tgtccttcga aacatctctg      1680
     acatccgaaa ttcttcaagt accaggctct acaaattcgc tgtatccgac tgaattggtg      1740
     ggccagttca acggctacgt catggacgtc tgcaatctgg tttggcgaaa tcgagggctc      1800
     aatggcgatg atccaaacgc acttggctgt ctgctgccac ctgctacaac gagtgcgctc      1860
     acacaataca ttcgggaatt gaacgaggca tcccgagaca gaaagcgcga ggcttcgttt      1920
     ttcttcaacc tgtcttccat tttctctctt agttaccatg tagccctgtg caacatgtca      1980
     gccggttgct tcgctgacat agaggaagaa aacaacatca cggagggcaa gcctagattg      2040
     agaaaacccg tgactcagaa ggcactgagt gcacttgaga aagacggtgg tgtcaagttg      2100
     acttggcagg agtacagggt gcgtatgctt gactggctag acgccacagg aagccgtggg      2160
     attgggaact tgatgcgcag tacgatgaaa gctttacgta aggattga                   2208
//

If you have problems or comments...

PBIL Back to PBIL home page