(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE294

ASFUM1_6.PE294       Location/Qualifiers
FT   CDS_pept        join(complement(930094..930138),complement(928963..930027),
FT                   complement(928422..928907),complement(928050..928370))
FT                   /codon_start=1
FT                   /gene_family="HOG000201405" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264326"
FT                   /orf_name="AFUA_6G04110"
FT                   /product="CLPTM1 domain protein"
FT                   /protein_id="EAL85628.1"
FT                   /db_xref="HOGENOM:HBG027580"
FT                   /db_xref="HOGENOM:HBG560750"
FT                   /db_xref="InterPro:IPR008429"
FT                   /db_xref="UniParc:UPI000051FFD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDB0"
FT                   /transl_table=1
FT                   /translation="MPEQRQRREEQESGGSGLKGALQGLAVFMLTQFLISQFFGNKSQN
FT                   AGSGVKPGELTSFQARPPRSEIADYSPIPDTVAPIWPPNSAVDISIYVSPSIVLPSLSS
FT                   LPSDSLVLSEKNFTIGNYSDTREIATTIEIPKEVQQNGTLWAHFYVALTGHQLDPTAKD
FT                   YSTDSAVHFFRPLNHYLPKKKVKKLKNLLASSDDTEEEEEDNSIPDVSIASYYHPNFTV
FT                   SLIPDSGVQKYRQVHPAIRHHMQLEATGARDASGQNGWYYPIVFLNTFWQLRSHMTELN
FT                   STVKTMPLRITLNNLSNWKFSMMASVDENAKANARQAAFGGSVPGGGDGSEFEMVKEIL
FT                   LDTNIWLLGTTGVVTILHMIFETLAFKNDISHWRKKKDVVGTSVRTILANVFMQTVIFL
FT                   YLMDNSENTSWMILASQGFGILLEAWKITKTVNVRLRAPPAGSFYSFLPYVVVFEDKHK
FT                   LSETEKKTKEYDEIAFRWLYIIAVPLLGAYAAYSLIYNTHKSWYSYIIETLVGSVYAYG
FT                   FLMMVPSLYINYRLKSVAHMPGKALTYKFLNTFIDDLFAFTVKMPWLHRLATLRDDVIF
FT                   FIWLYQSYKYKVDYKRVNEFGQGGDSDEEAEEPAAAESEKKLEAVSEASGRDNAEKSAR
FT                   KRK"
     atgccagagc agagacagcg cagggaagag caggagtctg gcggctccgg cctgaagggt        60
     gctcttcagg gtctcgccgt tttcatgttg acacagtttc tgatctctca atttttcgga       120
     aataaatcac aaaatgctgg atctggagtg aagcctggcg aattgacctc cttccaagct       180
     cgtccgcctc gcagcgaaat cgccgactac agtcctatcc ccgacaccgt tgctccaatc       240
     tggcccccta acagcgccgt tgatatcagc atctatgtct caccttccat tgtcctccct       300
     tctctcagct cactgccatc tgattctctt gtattgagtg aaaagaactt cacgatcggg       360
     aattacagtg acaccaggga aatcgcgact accatcgaga ttcccaagga agtccagcaa       420
     aatggaacgc tttgggcgca tttctatgtt gcgctgaccg gacaccaact cgacccaacg       480
     gctaaggatt atagcacaga tagtgctgtg cacttcttcc gcccactcaa ccattatctt       540
     cccaagaaaa aggtcaagaa gctcaagaac ttacttgcca gctcggacga taccgaagag       600
     gaggaagaag acaacagtat tccggatgtc tctattgctt catactacca ccccaacttc       660
     acggtatcgc tgattcctga ttctggagtt cagaaatacc gccaagtaca ccctgctatt       720
     cggcatcaca tgcaactcga ggccacgggc gcaagagatg cctctggtca gaatgggtgg       780
     tactacccta ttgtgttctt gaatacattt tggcaactcc gaagccatat gaccgagctc       840
     aattccacag tgaagacgat gcctttgcgg atcactctga acaatctgtc caactggaaa       900
     ttcagcatga tggcaagtgt ggacgagaat gcaaaggcta acgcccggca ggccgcattt       960
     ggaggttccg tgcctggagg cggcgatggc tctgagtttg agatggtcaa ggaaatcctc      1020
     cttgacacga acatttggtt gcttggtaca actggcgtag ttacgattct gcacatgatc      1080
     tttgaaactt tggcatttaa gaacgacatt tctcactggc gcaagaagaa ggacgttgtt      1140
     gggacctcag tccgcactat tttggctaac gtgttcatgc aaacggtcat cttcctctac      1200
     ttgatggata acagtgaaaa cacttcctgg atgatccttg ccagccaagg cttcggtatc      1260
     ttactggagg cgtggaagat caccaagaca gtgaatgtgc gtcttcgtgc accgccagcc      1320
     gggtctttct actctttcct cccttacgtt gtggtattcg aggataagca caagctttcg      1380
     gaaactgaga agaagaccaa ggagtatgat gaaattgcat tccgttggct ctatatcatt      1440
     gctgtgcctc tccttggtgc atatgcagct tacagcttga tctacaacac gcacaaatcg      1500
     tggtattcct acattattga aacgcttgtc ggcagcgttt acgcatatgg ctttttgatg      1560
     atggtcccca gtctctatat caactaccgt ctgaagtctg ttgctcatat gcctggcaag      1620
     gccttgacat acaaatttct caacactttc atcgatgatc tgttcgcatt taccgtcaag      1680
     atgccatggc tccaccgtct tgccactctc cgcgatgatg tgattttctt tatctggctc      1740
     taccagagct ataagtacaa agttgattac aagcgggtta atgaatttgg acagggaggc      1800
     gacagcgatg aggaggctga ggagccggca gcagccgaat ccgagaagaa gttggaggcg      1860
     gtgtctgaag cgtctggaag ggacaatgct gagaagtcgg cacggaagag gaagtaa         1917
//

If you have problems or comments...

PBIL Back to PBIL home page