(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE295

ASFUM1_6.PE295       Location/Qualifiers
FT   CDS_pept        join(930498..930778,930834..930919,930978..931142,
FT                   931195..931269,931325..931569)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207683"
FT                   /orf_name="AFUA_6G04120"
FT                   /product="Short chain dehydrogenase/reductase family
FT                   protein"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85626.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056220"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F414"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDB2"
FT                   /transl_table=1
FT                   /translation="MTDNPPPPDYSRPQFPAHSEPRVWLITAGDSPIGISVTRQVLKHG
FT                   DYALVGLAHTYLDLDECRREAFGEFLAEVESHRGEGWVERFKTVPLDIRMIGQCQALVA
FT                   EAVAAFGKVDILLCCTSQTLVGAVEELAASQQTLNLVKDQFETNYFGPLNIIKATLPHM
FT                   RKQKSGHIMILSSITAHIGTPGLGMYSAAGWALEGFCDVKPCIRNRPIQREAHNLPMQH
FT                   RNWYPDKLGHQCASHSSSVLSCCQSCPFVPWYIEQTGYSPAPPTDSGHGERSPKLKSSQ
FT                   LC"
     atgactgaca atccaccccc tcccgattat tcccgccccc agtttcctgc ccatagcgaa        60
     ccgcgagtat ggcttatcac tgcaggagac tcgcccattg ggatatcggt cacccgccag       120
     gttcttaagc acggagacta tgcgttagtc ggactggcgc atacgtactt ggacctggac       180
     gaatgccgtc gcgaggcgtt cggggagttc ctggctgaag ttgagagtca ccgcggcgaa       240
     ggatgggtgg aacgtttcaa gacagtccct ttggatatca gaatgatagg gcaatgtcaa       300
     gccttggtcg ccgaggcagt cgcagcattc ggcaaggtag acatcctact ctgctgtact       360
     agccagaccc ttgtcggcgc agtagaggag cttgcagctt ctcagcaaac cttgaacctg       420
     gtcaaggatc agtttgaaac caattacttc ggtcctctga acatcatcaa agcaacgctg       480
     cctcacatga ggaagcagaa atccggtcat atcatgattc tttctagcat tactgcccac       540
     atcggtacac cgggccttgg gatgtactcc gccgctggtt gggccctgga gggattttgc       600
     gatgtaaagc cttgcatacg aaatcgcccc attcaacgtg aagctcacaa tcttccaatg       660
     cagcatcgaa attggtatcc tgacaaactt ggtcaccagt gtgcctccca tagttccagc       720
     gtactctcct gctgtcaatc atgccccttt gttccgtggt atattgaaca gactggttac       780
     tcgcctgccc caccaacaga ctcagggcac ggagaacggt ccccaaaact caaatcgagt       840
     cagctctgct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page