(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE299

ASFUM1_6.PE299       Location/Qualifiers
FT   CDS_pept        937642..938424
FT                   /codon_start=1
FT                   /gene_family="HOG000201441" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207685"
FT                   /orf_name="AFUA_6G04180"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85622.1"
FT                   /db_xref="HOGENOM:HBG056217"
FT                   /db_xref="InterPro:IPR013957"
FT                   /db_xref="UniParc:UPI000051E82A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDB6"
FT                   /transl_table=1
FT                   /translation="MAEPPAKRAKRVDSSTMWDLDERKTRSPEPDSDIGRSPRRDAPQK
FT                   DDRRREGPRDDRRYRSRSRDRAERRRERSRSRDRRDRDRDRDRDRTDRDRDGRGARDRD
FT                   TSATRERHYDRRGMPYPTDEIDLLIPNALQGYRDRYRSRSRSPIRNGNRNRTRTPPPRG
FT                   PKGDRRDDRKDNRPYANGVPHSSLRRDKDEMELDPAVPIEEDEMEALMRKTVGFTRFRS
FT                   TKNTKVPGNNIYGVRKEKKTVYRQYMNRVGGFNRPLSP"
     atggcagagc cccccgcgaa aagagcaaaa cgggtcgata gctcgacaat gtgggactta        60
     gacgaacgaa aaacgcgttc tcctgagccg gactcagata ttggccgaag ccctcggcgt       120
     gacgcacctc agaaggacga tcggcggcgt gaggggcccc gtgatgatag aagatatcgt       180
     tcccggtcaa gagatcgagc tgaaaggcgt agagaaagga gcaggtctcg cgatcggcgt       240
     gaccgggacc gggaccgcga tcgcgatagg acagatcggg atagagacgg tcggggagca       300
     agagacagag atacaagcgc gaccagagaa agacattatg acagacgagg tatgccgtat       360
     cctactgatg aaattgattt acttatacct aatgctcttc aaggatatcg agacagatac       420
     cgctcccgct cccgctcacc tattcggaat gggaatagga acaggactag aactccacca       480
     cctcgagggc cgaagggaga tcgcagagac gatcgcaaag acaaccgtcc gtatgcaaat       540
     ggcgtcccac attcatcgtt acgacgagac aaggacgaga tggagttgga ccccgcagta       600
     ccgattgaag aagatgaaat ggaggcgctg atgcgcaaga ccgtgggctt tacaaggttc       660
     aggagcacaa agaataccaa agtgcctgga aacaacatct acggtgtgcg gaaagagaag       720
     aagactgtgt acagacagta catgaaccgt gtaggcggat ttaacaggcc cctcagtcct       780
     taa                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page