(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE303

ASFUM1_6.PE303       Location/Qualifiers
FT   CDS_pept        join(complement(947760..947803),complement(946489..947605))
FT                   /codon_start=1
FT                   /gene_family="HOG000201452" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264329"
FT                   /orf_name="AFUA_6G04220"
FT                   /product="Putative uncharacterized protein "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL85618.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG097646"
FT                   /db_xref="HOGENOM:HBG603845"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI000052092A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC0"
FT                   /transl_table=1
FT                   /translation="MAASSERREIVIVGIVTLIEATEIAGGASGKAGGLLALWAYPSSI
FT                   VPLSYKLHADLAKEHNGKVRWGYREVGCGQIVVKGRPLNEKKDVGEKDTGSSLSLQKRS
FT                   DAAIAKLRKAKFPPDLDWIDPLLIRGYESISDPGETAQVHPYLFTTSIAKLAEEKGAEI
FT                   KLGSVTKIGYAGDAVESVTYNDKESGESRTISATDVIIAAGPWTRTVMPEAPISAMRAH
FT                   SVVIRPTKPVSAHTLFTNIEIPANFDPSKPSRPTVVSPEIYARPDETVYACGEGDQVVP
FT                   LPKTTADVEVDQRRCQDIIDQVGSISDELRDGQVCARQACYLPNVSVRGGPLIGHTGTK
FT                   GLYLAAGHTCWGIQNAPGTGKLISEFVFDGDAKSAKIGSLDPRNFL"
     atggcggctt cgagtgagcg tcgagaaatt gttatcgtcg gtatagtgac tctgatcgag        60
     gcgacagaaa ttgccggagg cgcatcaggc aaagctggtg gactgctggc gctatgggca       120
     tatccaagca gtatagttcc tctgagctac aagctgcacg cggatctggc caaggaacac       180
     aacggtaaag taagatgggg ctatagagag gttggctgtg gacagattgt tgtgaaaggc       240
     cgtcctctta atgaaaagaa ggatgtcggc gagaaggaca cgggaagctc attatccctt       300
     caaaagcgga gtgatgctgc tattgcgaaa ctacggaaag ccaaatttcc gcctgatctg       360
     gattggattg atcccctact gatcagaggc tatgagagca taagcgaccc cggcgagacc       420
     gcccaagtcc acccttacct cttcactaca tcaatcgcaa agcttgccga ggagaaaggc       480
     gcagagatca agttgggatc agtgacaaaa attggttacg caggggatgc tgtggaatca       540
     gttacataca atgataagga atccggagag tcgcgcacaa tttcggcgac ggacgtcatc       600
     attgccgctg gtccctggac acgaacggtc atgccggaag ctcccatatc ggcaatgcgc       660
     gctcacagtg ttgtcatccg accgaccaag ccggtgagcg ctcatactct atttacgaac       720
     attgaaatac ctgccaactt cgatccatcg aagccctcac gccccacagt cgtgtcccct       780
     gagatctacg cccgccccga tgagacggta tacgcttgtg gcgagggtga ccaggttgtc       840
     ccgcttccaa agaccacagc agatgttgaa gtggaccaga ggcggtgcca ggacatcatc       900
     gatcaagtgg gcagcatatc cgatgagctt cgggacggac aggtttgcgc acggcaagct       960
     tgctacttgc ccaacgtcag cgtacgggga ggtcccttga tcggccacac tggcactaaa      1020
     gggctctacc ttgctgctgg acacacctgc tggggtatcc agaacgctcc cggaaccgga      1080
     aagcttatca gtgaatttgt cttcgatggc gatgcaaaga gcgccaagat cgggtctcta      1140
     gatccgagga actttctctg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page