(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE305

ASFUM1_6.PE305       Location/Qualifiers
FT   CDS_pept        join(951674..951721,951808..951997,952062..952465,
FT                   952501..952503)
FT                   /codon_start=1
FT                   /gene_family="HOG000201506" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056393"
FT                   /orf_name="AFUA_6G04240"
FT                   /product="PAP2 domain protein"
FT                   /EC_number="3.-.-.-"
FT                   /function="hydrolase activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85616.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG058366"
FT                   /db_xref="HOGENOM:HBG327849"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI0000520464"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC2"
FT                   /transl_table=1
FT                   /translation="MEDTPLASLSLTHVHYNPEDPLSLLSAWLALVPQALCVAYVTLIW
FT                   ASREMEVILMFSGQMGCEAFNFVLKRIIKEERPKQMLGKGYGMPSSHAQFVTYFAVYLT
FT                   LFLLVRHIPTVPKPDTTSYFLMRMALAAGVCLGAGAVATSRIYLNYHTPKQVLAGCAAG
FT                   VLCAVSWFVATSFLRTEGYVDWVLDLGISQFLRLRDLVVSQDLAEAGWLQW"
     atggaagata caccactggc atcgctgtcg ttaacccatg tgcattataa ccctgaagac        60
     ccgctctcct tactttcggc ctggctcgcc cttgtacccc aagcgctatg tgtggcctac       120
     gtgacactga tctgggcttc gagagaaatg gaggtaattc tcatgttttc tgggcaaatg       180
     ggttgtgagg cattcaattt tgtgctcaag cgaattatca aagaggaaag gccaaagcaa       240
     atgcttggga aaggctacgg aatgccatcg tcccacgccc aatttgtcac atatttcgct       300
     gtctacctga ctctgttcct cctcgtccga catattccaa ccgttccaaa gcctgatacg       360
     acatcctatt ttctcatgcg gatggcactc gctgcgggag tgtgtctcgg ggctggcgcg       420
     gtggccacca gccgcatcta tttgaactat catactccaa aacaggtgct agcaggatgt       480
     gctgctggcg ttctgtgtgc ggtatcctgg tttgtggcta cgagcttttt gcggacggag       540
     ggttatgtgg attgggtatt ggatctggga atatcccaat tcttgagact tcgcgactta       600
     gtggtaagtc aggatctcgc agaagccgga tggctccaat ggtga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page