(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE308

ASFUM1_6.PE308       Location/Qualifiers
FT   CDS_pept        958636..959376
FT                   /codon_start=1
FT                   /gene_family="HOG000201539" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264332"
FT                   /orf_name="AFUA_6G04265"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27237.1"
FT                   /db_xref="HOGENOM:HBG325045"
FT                   /db_xref="UniParc:UPI0000F51CDF"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA19"
FT                   /transl_table=1
FT                   /translation="MTSYFSSITSSSAISNISTRLNSLRRAITSGDEADDPENEDCSHI
FT                   SNVLRAYYTEKGRPFPSWLPPDPKAPAPAPSRTIATTQIQPGTYGHGSAGTTSAPGRGG
FT                   GLSDLWGDSGASQQPPASQTASLRRGRLAPGSAGAPLSTVHSAPSGSVVTPPSGSPTPP
FT                   TAHPPGARPLPSQRAGSYQTIASGQASLERAASAQERLRARLHGGRSPSPAQTPPGGSR
FT                   PGSPYYGGGPDPSVRKPVGMPGRR"
     atgacctcct acttctcttc gattacctcg tcgtcagcaa tctccaacat cagcacgcga        60
     ctcaactctc tccgccgtgc catcacttct ggagatgagg ccgacgaccc agaaaacgaa       120
     gactgctctc acatctccaa tgttctgcgt gcctactaca cagagaaagg ccggcccttt       180
     ccatcatggc tccctccgga ccctaaagct ccagcacccg caccttcccg aaccatcgca       240
     accactcaga ttcagccagg cacctacgga cacggctcag cgggcacaac ctcagccccg       300
     ggacgcggtg gcgggctgag cgatctatgg ggagactctg gagcttctca acaaccacca       360
     gcatcacaaa cggccagttt gcgacgagga cgtctggcac ctgggagcgc aggcgccccg       420
     ctgtcgacgg tgcacagcgc tccttctggc tcagtggtta cacctccctc aggatcaccg       480
     acaccgccga ctgcgcatcc acctggggca cgacctctcc ccagtcagcg tgcgggatca       540
     tatcagacga tcgcatccgg ccaggcgtct cttgagaggg ctgcgtctgc gcaggagaga       600
     ctccgagcgc gcctgcatgg agggcggtcg cctagcccgg cccagactcc tccgggcggc       660
     agtcggccgg ggtcacctta ttacggggga ggtccagatc cgagtgtgcg aaagcctgtt       720
     gggatgccgg gacggcggta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page