(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE309

ASFUM1_6.PE309       Location/Qualifiers
FT   CDS_pept        join(960907..961462,961522..962621)
FT                   /codon_start=1
FT                   /gene_family="HOG000201550" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264333"
FT                   /orf_name="AFUA_6G04270"
FT                   /product="MFS sugar transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EBA27236.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG325044"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51CEF"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA18"
FT                   /transl_table=1
FT                   /translation="MAVKDVEVPLDDHKEVAEEMDDIQNDLKSEAFNEAAMDAELQQLE
FT                   AQLGSVKQSRLELTFANPAYFTYVLVAFASMGGLLSGLDQSLISGANLTMPKALHLSAS
FT                   QASLVNAGMPLGAVGGALILGPCNEFLGRRMAIIVSCILYTIGAGLEAGAINFGMMFGG
FT                   RFVLGMGVGLEGGTVPVYVAESVPGKIRGNLVSLYQLNIAFGEVLGYAVAAMFFGVAGD
FT                   WRYILGSSLVFSTILLVGMLFMPESPRYLMHKGRPVEAYGVWKRIRGFDSYESKEEFLG
FT                   MRQAVAAENEEQANTKKWAWLDFFTNGRARRAMIYANIMVFLGQFTGVNAVMYYMGVLM
FT                   TKIGFDDRTSVYMSLVGGGSLLIGTIPAVLYMERFGRRYWANVMLPGFFIGLVLVGAGY
FT                   TIDYKTYPATAEGLYLTGIILYMGFFGSYACLTWVIPAEVFPTYLRSYGMTTADANLFL
FT                   CSFIVTYNFTAMMNSMTRIGLTLGFYGGIAVLGWFYQVLFMPETKNKSLEEIDELFSKP
FT                   TSVIVKQNIKSTVEIMRDLSHLRFRKVFSPSPRL"
     atggctgtta aagatgttga ggttcctctc gacgaccaca aggaggtcgc cgaagagatg        60
     gatgatattc aaaatgacct caagtccgag gctttcaacg aagctgccat ggatgctgag       120
     ctccagcagc tggaagcaca gctcggcagc gtaaaacagt ctcggcttga gctcactttc       180
     gccaaccccg cttacttcac ttacgttctg gtcgcctttg cgtctatggg tggtctactc       240
     tctggtctgg atcagtcgtt gatcagcggt gcgaacctca ccatgcccaa ggctttgcat       300
     ctgtccgcct cgcaagctag tttggtcaac gccggtatgc cacttggtgc cgtcggtggt       360
     gccctgatcc ttggtccatg caacgagttc cttggtcggc gcatggccat cattgtctcc       420
     tgcatccttt acactatcgg tgctggactc gaagccggcg ccatcaactt tggcatgatg       480
     ttcggcggcc gattcgttct tggcatgggt gtcggtcttg agggtggtac tgtccctgtc       540
     tacgtcgccg agtctgtccc cggtaagatc cgtggtaacc tggtctcttt gtatcagttg       600
     aacattgctt ttggtgaggt cctcggctat gcagttgccg cgatgttctt tggtgtcgcc       660
     ggcgactggc gctacattct cggctcttcc ctggtcttct caaccatcct tctggtcggt       720
     atgctcttca tgcctgagag cccccgttac ctgatgcaca agggaagacc ggtcgaggcg       780
     tatggtgtgt ggaagcgcat tcgcggcttc gactcttacg agtccaagga ggaatttctg       840
     ggcatgcgtc aagctgtcgc cgcggagaac gaagaacaag ccaacacgaa gaagtgggct       900
     tggctggact ttttcactaa tggccgggct cgccgcgcca tgatctacgc caacatcatg       960
     gtattcctcg gtcaatttac gggtgtgaac gcagttatgt actacatggg tgttctgatg      1020
     acgaagatcg gcttcgatga ccgtaccagt gtctatatgt cgctcgttgg aggtggatcc      1080
     ctgttgatcg gtactattcc cgcagtgctg tacatggagc ggttcggtcg acgctactgg      1140
     gccaacgtta tgcttcctgg tttcttcatc ggtctggtgc tcgtgggagc aggctacacc      1200
     atcgactaca agacctatcc ggccacggct gaaggtctct atttgaccgg tatcatcctt      1260
     tacatggggt tcttcggctc ctatgcctgc ttgacctggg tcattcccgc cgaggtcttc      1320
     cccacttatc tccggagtta cggcatgacc actgcggacg ccaacctctt cctgtgctcc      1380
     ttcatcgtca cctacaactt taccgcgatg atgaattcga tgactcgtat cggtctcacg      1440
     ctcggtttct acggaggtat cgccgtcctg ggttggttct accaggtcct cttcatgccc      1500
     gagaccaaga acaagtccct cgaggagatt gacgagcttt tctccaagcc tacctctgtt      1560
     atcgtcaaac agaacatcaa gagcactgtc gagatcatgc gcgacctgtc tcacttgcgc      1620
     ttcagaaagg tctttagccc tagtcctagg ctgtag                                1656
//

If you have problems or comments...

PBIL Back to PBIL home page