(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE310

ASFUM1_6.PE310       Location/Qualifiers
FT   CDS_pept        join(complement(964148..964300),complement(963707..964079),
FT                   complement(963551..963636),complement(962988..963458))
FT                   /codon_start=1
FT                   /gene_family="HOG000201285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264334"
FT                   /orf_name="AFUA_6G04280"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL85612.2"
FT                   /db_xref="HOGENOM:HBG056209"
FT                   /db_xref="UniParc:UPI0000F51CF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC6"
FT                   /transl_table=1
FT                   /translation="MNDIPNPHGTGLVVLIWILTGISVVVVSLRVLAKTKIRQFRIDDV
FT                   VMIVVLILGIISGSLHTTAVKYGYGLPDATVPEPVATTGRKFYIIGLASLILCSAVGRA
FT                   AFVLYLLAILGGQKGRRIILTALAILEMVFNSVSVILIFATCTPVSMVWDYAAEGTCTA
FT                   TSIQVNFGYFQSTFNVFVDLYLAVFRPISSGILNSNSESKSRDGRRYRQNRPTPEIYND
FT                   ALGGTVNLLRWGYIEADLVIITASLPCLRSVILSGFHYMTSSGHRSRSYELGAAYTGTH
FT                   AGTASVTAQATSHRKTDSRLRGMLSTRNRADDGASVDRILGSRNSLDGVETGGSSQEGS
FT                   AGIRKQVEVTVVADDRRKGV"
     atgaacgata ttccaaaccc gcacggaacg ggcctggtag tcctcatatg gattctgaca        60
     ggcatctcag tggtcgtggt ctctctgcgc gtcctggcca aaacgaagat tcgccaattc       120
     aggatagacg atgtcgtgat gatcgttgtg ctgatcctag gtatcatctc cgggtccctg       180
     cacaccaccg cagttaaata cggatacggt ctaccggacg caaccgtccc cgaacctgtc       240
     gcgacgacgg gtcgaaaatt ctacattata ggactggcct ctctgatcct ttgctcagcc       300
     gtcggccgcg ccgccttcgt gctatacctc ctagccatcc tgggcgggca gaaagggcgg       360
     cgcatcatct tgacggctct ggctatcttg gagatggttt ttaattctgt gtccgtcatc       420
     ttaatatttg ccacttgcac gcctgtgtcc atggtctggg attacgcggc tgaggggacc       480
     tgcacggcaa cctccatcca ggttaacttt ggatatttcc agagtacatt caatgtcttc       540
     gtcgatctgt acctagccgt cttccgacct atatcttctg gcatcttaaa ctcaaactcg       600
     gaatcaaaat cacgcgatgg ccggcgctat cgtcaaaacc gtccaactcc cgagatctac       660
     aacgacgccc taggcggcac agtcaacctc ctccgctggg gctacatcga agcagacctg       720
     gtgatcatca ccgcgtcgct gccttgtctc cgctcggtta ttctctcggg attccactat       780
     atgacgagta gcggacaccg gtctcgctcg tatgagcttg gcgcagcgta tacggggacg       840
     cacgcgggga cggcgtcagt tacagcgcag gcgacttcgc atcggaagac tgattcgcgg       900
     ttacgtggga tgctgtcgac caggaatcgg gccgatgatg gggcaagtgt tgatcgtata       960
     ctcggtagtc gaaatagtct cgatggggtg gagacgggtg ggagtagtca agaggggtcg      1020
     gctgggattc ggaagcaggt tgaggtcact gttgttgcgg atgatcgtag gaagggtgta      1080
     tag                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page