(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE323

ASFUM1_6.PE323       Location/Qualifiers
FT   CDS_pept        complement(1009432..1010409)
FT                   /codon_start=1
FT                   /gene_family="HOG000201086" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056654"
FT                   /orf_name="AFUA_6G04410"
FT                   /product="DUF1183 domain protein"
FT                   /protein_id="EAL85599.1"
FT                   /db_xref="HOGENOM:HBG056199"
FT                   /db_xref="HOGENOM:HBG328308"
FT                   /db_xref="InterPro:IPR009567"
FT                   /db_xref="UniParc:UPI000051F8C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDD9"
FT                   /transl_table=1
FT                   /translation="MYYPGINSLLLWLLCFAPPGLAYGRSSESPPGPNAILLSRVQSLT
FT                   LRANRLTSSRRVSPIPQLKCVGPSKTICDKYKIETMRCTNAGYDYDEEDVQWTCTAQLP
FT                   EEFMLGATDVICEGYRNADDKWVLKGSCGVEYRLLLTERGESRFGRIQEDDMRSIPLAT
FT                   KGWRRGMDALVDLIFLGFWAAVLVMIFWPMVRSCFGLRGRRGRTNVGRGWGGFWGGGGG
FT                   GGGDGGGNDYGPYPGPPPPYSSFPDNSSCSSQPGWRPGFWTGAAAGGMAGYEMGRRSNR
FT                   HDRPSSSRWFDDREPWRESNTQPRSPPRFSATTESTGFGSTRRR"
     atgtactacc caggcattaa ctcactacta ctatggcttc tatgctttgc tcccccaggg        60
     ctcgcatacg gcagatcttc agaatcgccg cccgggccaa atgccatact cctctcgcga       120
     gtacagtcgc tgactctacg cgccaatcgt ctcacgtcct ctcgccgtgt ttccccgatt       180
     ccacagctga aatgcgtggg accctcaaag accatctgtg acaagtacaa gatagagact       240
     atgcgatgca cgaatgctgg atacgactac gacgaagaag atgtccagtg gacgtgcact       300
     gcacagcttc cggaggagtt catgttgggc gcaacagatg tgatctgcga gggataccga       360
     aatgccgatg acaagtgggt gttgaagggc agctgcggtg ttgagtaccg gctactgttg       420
     acggagcgcg gggagagccg atttggcaga atacaagagg atgatatgcg gtccatcccg       480
     cttgcgacaa aaggatggcg ccgagggatg gacgctctag tggacctcat tttcttagga       540
     ttctgggctg cggttctcgt tatgattttc tggcctatgg tccgctcctg ttttgggctg       600
     cgaggtcgtc gaggcaggac caatgttgga cgaggttggg gcggattttg gggaggagga       660
     ggtggtggtg gtggtgatgg gggaggaaat gactatgggc cttatcctgg gccacctcct       720
     ccctacagca gctttccaga taatagttcg tgttcatcgc agccagggtg gaggccgggt       780
     ttttggaccg gtgctgcggc tggtggcatg gccggctacg agatgggtag gagaagcaat       840
     cggcatgaca gaccgtcatc ctctagatgg tttgatgacc gcgagccttg gagagaaagc       900
     aacacacagc cgcgttcccc tcctcggttt tcggctacta cggagagtac gggattcggc       960
     tcaacaagac ggagataa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page