(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE324

ASFUM1_6.PE324       Location/Qualifiers
FT   CDS_pept        join(1010554..1010686,1011001..1012427)
FT                   /codon_start=1
FT                   /gene_family="HOG000201075" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265325"
FT                   /gene_name="mmm1"
FT                   /orf_name="AFUA_6G04420"
FT                   /product="Maintenance of mitochondrial morphology protein 1"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85598.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG056198"
FT                   /db_xref="HOGENOM:HBG397194"
FT                   /db_xref="InterPro:IPR019411"
FT                   /db_xref="UniParc:UPI000051F8C0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDE0"
FT                   /transl_table=1
FT                   /translation="MTAKAQRVLTERRELVGHFGVQSRYGCDKQLLHLRLVLAEADRVR
FT                   FLLGQLSVVLLIAAFIKFFIFGEAPPPPSRGLSHRSATHRRSNSIFSSAQHDGSTRTLR
FT                   EKPSNSNVLRPVPSSATNTRSILRKTYYTAIPTNPSSKHGRHRIHHSSHQPESLDWFNV
FT                   LIAQTIAQYRQTAYLLKDSPTSSILNSLTAALNNPEKKPSFIDKITVTDISLGEEFPIF
FT                   SNCRIIAVDDPNSDGGRLQALMDVDLSDDNLSIAVETQLLLNYPKPCSAILPVALSISV
FT                   VRFSGTLCISLVPASTPPLDTPSHSPSPPTAQTTTAGRSKREDQTSGSHSHAGGSSKEP
FT                   SGENPPKTSPKSNVAFSFLPDYRLDLSVRSLIGSRSRLQDVPKVAQLVEARVHAWFEER
FT                   VVEPRVQVVGLPDLWPRMGRTGVRTGDDSETGSNVPRSSTAADASGSARHEDSSREPEV
FT                   LRFGSLLGTRPPFDLASRTSSFNVETGDLRSRSMTREESNGNLSDQFHMPGSLPGSGVA
FT                   TT"
     atgactgcga aagctcaacg tgtccttaca gagaggcgcg agctcgtggg tcattttgga        60
     gtccaatcgc gatatggatg tgataagcag ctgctccatc ttagactagt cttggccgag       120
     gctgacaggg tccggttctt gctgggacag ctctccgtag tgcttctcat tgctgccttc       180
     atcaagttct tcatcttcgg cgaagcacca cctccgccct ctcgtggcct ttctcatcgt       240
     tcagcgactc atcggcgttc taattcgatt ttcagcagcg cacagcatga tgggagcaca       300
     agaacattga gagaaaagcc atctaactcg aacgtcctac gtccggtacc gtcctccgcg       360
     accaacaccc gctccatcct gcgaaagacc tactacactg caatccccac caatccctcc       420
     tcaaaacatg gacgacacag gatacaccat tcttcgcacc agccagagtc gttggactgg       480
     ttcaatgtcc tcatagctca gaccatcgct caatacaggc aaacggcata tctgttgaag       540
     gactcaccga catcatcaat cctcaactcg ctaacggcgg ccctgaataa ccccgagaag       600
     aagccatcat ttatagataa aattactgtg acggatatat ctctggggga ggagtttccc       660
     atcttcagca actgtcggat cattgctgtg gatgatccaa attctgatgg tggacgcctt       720
     caggcactga tggacgtcga cctgagcgat gacaaccttt ccatcgctgt cgagacgcag       780
     ctgctcctca attatccaaa gccatgctct gccattcttc ctgtggcact ctccatttcc       840
     gttgtccgct tttccgggac cctttgcata tcactcgtcc ccgcttccac acctccactc       900
     gacactccat cccattcccc atctccccct accgcccaga caacaacagc tggacgctca       960
     aagcgtgaag atcagacgag tggaagtcac tctcacgcag gtggctcctc gaaggaaccc      1020
     agcggtgaaa atccgccgaa aaccagtcca aagagcaacg ttgcgttttc ctttcttcca      1080
     gactatcgac ttgacctctc cgtgaggtcg ttgattggct ctcgtagcag actccaagac      1140
     gtacctaaag tcgctcagct agttgaagcc cgtgttcatg catggtttga ggagcgcgtc      1200
     gtcgaacctc gggtgcaggt cgtgggactg ccggacctct ggcctcgcat gggcaggaca      1260
     ggcgtacgga ctggcgatga ttcggaaacg ggctctaatg tgccgcggag tagcacggcg      1320
     gcagatgcca gcgggtctgc ccgtcacgag gactcgtctc gcgaaccaga ggtgctcagg      1380
     tttggatcac tattgggcac acggccgccg tttgaccttg cttcccgaac gagcagcttc      1440
     aatgttgaaa ctggcgacct ccgcagtcgc agcatgacgc gggaagagag caatggtaac      1500
     ttgagcgatc aattccacat gcccggctct cttccaggaa gtggtgtagc tacgacttga      1560
//

If you have problems or comments...

PBIL Back to PBIL home page