(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE325

ASFUM1_6.PE325       Location/Qualifiers
FT   CDS_pept        join(complement(1013507..1013586),
FT                   complement(1013306..1013411),complement(1012867..1013238),
FT                   complement(1012672..1012800))
FT                   /codon_start=1
FT                   /gene_family="HOG000201071" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903377"
FT                   /orf_name="AFUA_6G04430"
FT                   /product="ARD/ARD family protein, putative "
FT                   /function="dioxygenase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="L-methionine salvage from
FT                   methylthioadenosine"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85597.1"
FT                   /db_xref="GO:0019509"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051213"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG020936"
FT                   /db_xref="HOGENOM:HBG660685"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000051FDB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDE1"
FT                   /transl_table=1
FT                   /translation="MSEGGGRADALRNANKQILPLICAITSLLTCCLLSERKTYSVGGP
FT                   AEKKHPTMKAYWYDNKPGDQREPHDSGRPVTVDYLASIGVQYYHFPSLESVNELAKERG
FT                   YKNRDEIVVSPQAMGDVYEEKVKMFFNEHLHEDEEIRYIRDGEGYFDVRGQEDEWVRIK
FT                   LAKDDLIILPAGIYHRFTTDDKNYVKAMRLFQEEPKWTPLNRGPDVDENSHRQSYLRTI
FT                   QNKTVA"
     atgtccgaag gcggtggaag agcggacgca ctccgtaatg caaataagca aatattgccc        60
     ttgatttgcg cgatcactag tttattgacc tgttgcctcc tatccgaacg caaaacatac       120
     tctgttggcg gtcctgcaga gaagaagcat cccaccatga aggcttattg gtatgacaac       180
     aaaccgggtg accagcggga accccatgac tccggccgcc cggtgacggt ggactatctc       240
     gcctccattg gagtccagta ctaccatttc ccctccctcg agtctgttaa tgaattggcc       300
     aaggaacgtg ggtacaagaa tcgtgatgag attgtagttt cgccacaggc gatgggtgat       360
     gtgtacgagg agaaagtgaa gatgttcttc aatgagcatc tgcacgaaga cgaggagatc       420
     cgctacatcc gtgatggcga gggttacttt gacgtgcgtg gtcaggagga cgaatgggtt       480
     cggatcaagt tggcgaagga tgacttgatc atccttcccg ctggtatcta ccatcgtttc       540
     accaccgatg acaagaatta cgtcaaggct atgcgccttt tccaggaaga gcctaaatgg       600
     actcccttga accgtggccc tgatgtcgat gagaactctc atcggcagtc ttaccttcgc       660
     acgatccaga acaagaccgt tgcttag                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page