(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE326

ASFUM1_6.PE326       Location/Qualifiers
FT   CDS_pept        join(1013702..1013808,1013872..1015846)
FT                   /codon_start=1
FT                   /gene_family="HOG000201059" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265326"
FT                   /orf_name="AFUA_6G04440"
FT                   /product="Mitochondrial translation optimization protein
FT                   (Mto1), putative"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="tRNA wobble uridine modification "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85596.1"
FT                   /db_xref="GO:0002098"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG001394"
FT                   /db_xref="HOGENOM:HBG284774"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="UniParc:UPI000051FB4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDE2"
FT                   /transl_table=1
FT                   /translation="MAFRARSVALWRWGSAPWSRIMGLTRGMATVSDGTRAYDVVVIGG
FT                   GHAGSEASAAAARSGARTALVTPSLSNIGVCSCNPSFGGIGKGTMIREIDAMDGVAGRI
FT                   IDKAGIMFRILNRSKGPAVWGPRAQIDRDLYKRYMQEELLATEGLSIVEGKVADIVVSK
FT                   EGVENIPGSQGKIVGVRLESGEVIPTGRVVITTGTFLGGEIHIGLEAYPSGRMGEAATF
FT                   GLSKSLREAGFQLGRLKTGTPPRLDMKTIDFAPLEVQRGDSPPQPFSYLNTTVDVGDEG
FT                   QLTCWMTHTNEASHEIVRANLDKSIHIRETVRGPRYCPSLESKIIRFTDKKQHQIWLEP
FT                   EGFAPNEVIYPNGISMTIPADAQYALLRTVRGLENVRMLQPGYGVEYDYIDPRNLRPTL
FT                   ETKLISGLYLAGQINGTTGYEEAAGQGIIAGTNAGLSAQGRQPLTLTRSDGFIGIMIDD
FT                   LITKGVSEPYRMFTARSEYRISTRSDNADLRLTRMARDAGVVSDKRWRSFTDTEAQIKE
FT                   LQNLLAKTKLSSTMWSRKGFKTRTDSSVRSALDLLCLDGVDIDALIPHIESPSGMAYTP
FT                   SSFDPIIRTRVSIEGRYAPYVKRQEAMARKFLQDESLILPPDLDYSKVQGISTEERQAL
FT                   ERVRPVSVGMARRIEGVTPAGALRLLMHVRRAMDASKESSLDADALEGSAESVLRGSV"
     atggctttcc gggcacggtc agtggctctt tggcgatggg gctctgctcc ttggtcccgg        60
     atcatgggcc tcacacgagg catggccacg gtttctgatg gtacccgggc atacgatgtc       120
     gtcgttattg gaggaggcca cgctggttcc gaggcctctg cagctgccgc tcgatctggc       180
     gcacgcaccg cattggttac gccctcgctt tcgaacattg gcgtttgttc atgcaatccg       240
     agttttggag gaatcgggaa aggaacaatg atccgcgaaa tcgatgccat ggatggtgtg       300
     gcagggcgaa tcattgacaa ggccggtatc atgtttcgca ttctcaatcg atccaaggga       360
     cctgctgtat ggggtccgcg cgctcagatt gatcgggatc tctataagag gtacatgcag       420
     gaggagcttc tcgctaccga agggctgagt atagtggaag gcaaggtcgc agatatcgtg       480
     gtgtcaaaag agggtgtgga gaacatcccg ggatcgcagg gcaagattgt cggagtacgg       540
     ctcgaatccg gagaggtgat acctactggg cgtgtcgtca tcacaactgg aacgttcctg       600
     ggtggagaaa tacacattgg acttgaagcg tacccttcgg ggcgtatggg tgaagcggct       660
     acgtttgggc tcagcaaatc ccttcgcgaa gcaggttttc agcttggtcg tctgaagacc       720
     gggactcctc ctcgtttgga tatgaaaacg atcgactttg cgccattgga ggttcagaga       780
     ggtgactcgc ctccgcagcc cttttcgtat cttaacacga cggtcgatgt tggtgatgaa       840
     ggtcagctta catgctggat gacccacacc aacgaggctt cacacgagat agttcgcgca       900
     aatcttgaca aatcgattca tattcgcgag actgtccgag ggccacgcta ctgcccctcg       960
     ttggaatcga agatcatacg ttttacggat aagaaacagc atcagatctg gctcgaaccg      1020
     gaaggattcg caccgaatga ggtcatctac ccgaacggta tctccatgac cattccggca      1080
     gacgcacaat atgccctact acgcacggtc cgcggccttg agaacgtgcg catgctacag      1140
     cctggctacg gcgtggagta cgactacatc gatccccgca atctccggcc gacgctggag      1200
     accaagctga tcagtggcct gtaccttgcg gggcagatca atggaacaac cggatatgaa      1260
     gaagctgcag gacaggggat cattgccggc acgaacgccg gtctgtctgc tcaaggccga      1320
     cagcctctca ctctcacccg gtcggacggt tttatcggaa tcatgatcga cgacctcatc      1380
     accaagggag tatccgaacc ctatcgtatg ttcacagcaa gaagcgaata tcgcatctcg      1440
     actcggtctg acaacgccga tctgcggctc acacgtatgg cccgtgacgc cggcgtggtg      1500
     tcggacaagc ggtggcgttc cttcactgac acagaagcgc aaatcaagga gttgcaaaac      1560
     ctcctcgcca aaacgaaact ctcatctact atgtggtcgc gcaaaggatt caaaactcgg      1620
     actgacagct ctgtccgctc ggcgctcgac ctcctctgcc tcgacggtgt ggacatcgac      1680
     gccttgatcc cccacatcga atcgccatcg ggcatggctt atacaccctc ctcattcgac      1740
     cccataatcc gaacccgggt cagcatcgaa ggccgctacg ccccttatgt caagcggcaa      1800
     gaggcaatgg cgaggaagtt cctgcaggat gaaagcctca tcctacctcc ggatttggac      1860
     tactcaaagg tgcagggcat cagtaccgag gaaagacagg ctctcgagcg cgtccgcccc      1920
     gttagtgtgg gaatggcgag gcgcatcgaa ggagtcacgc cggcgggtgc tctgcggttg      1980
     ctgatgcatg tccgccgggc catggacgcg agcaaagaat catcactcga cgcagacgcg      2040
     cttgagggct ctgcggagag cgtgttacgt ggatctgttt ga                         2082
//

If you have problems or comments...

PBIL Back to PBIL home page