(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE329

ASFUM1_6.PE329       Location/Qualifiers
FT   CDS_pept        join(1021896..1022849,1022936..1023454)
FT                   /codon_start=1
FT                   /gene_family="HOG000201027" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265327"
FT                   /orf_name="AFUA_6G04470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85593.1"
FT                   /db_xref="HOGENOM:HBG056197"
FT                   /db_xref="UniParc:UPI0000520463"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDE5"
FT                   /transl_table=1
FT                   /translation="MPILNGPAQEAPVPRDSAVPGNKQKKLETRSIEPQMPADPNLANP
FT                   RLLLNGACIYERQLPGDAYITAHVQRLQHGFHSSPAVSDKDYDHVDFLGINFVFHSPNT
FT                   LAHRFKAATIRASVQGTRHVASSDHYPNGYPPGNPRFLMHAPHLIFGAISPETLQWNYS
FT                   LTGSLGVVDLPVMASLSPTGGINGRYRRYEMMRIQGSVRTLKSPRGRKFDIDAGEIVWS
FT                   LEENNLQRSGLPREFTFAMLIQKPRADSRIVFSLDIEPTLQSWYGSYPDWWLSLPKYQP
FT                   QSRRPVDFRSEVGQRFEPAESKKGFNFATLESSFDDYIPSDGGVLQDDNDTLQDTNHDR
FT                   TIVEPIRGVARLAYPNTLAGAAATATSAPAPGEPALIARRGTLGSDRSALTIHLLMDNQ
FT                   MPSPLSSLRGSRPSPKLTSHSNIHGNSATKQDKADRRESPRALPAATIPAPPQRQTTLR
FT                   RTRSREGLNRNLNLDHHHHPKPRPQVSDRRFN"
     atgccaatct tgaatggtcc ggcgcaggag gcgccggtgc ctcgcgactc tgctgtccct        60
     ggcaacaagc aaaagaaact tgagacgcgc agcatagaac cccagatgcc tgctgatccc       120
     aatctggcaa acccgcgact attgcttaac ggagcctgta tctacgagcg tcaactgccc       180
     ggcgacgcat acatcacggc gcatgtccag cgactgcagc atggatttca ctccagccct       240
     gccgtttccg acaaggacta cgatcacgta gacttcctcg ggatcaattt cgtcttccac       300
     tcacccaaca ctttggcgca tcggttcaag gcggccacaa ttagagcctc tgtgcagggc       360
     acccgacacg tcgcttcgtc ggatcattac ccgaacggct acccgccggg aaacccgcgc       420
     ttcctcatgc atgcaccaca tctgatcttc ggcgctatat cgccagagac actgcagtgg       480
     aactacagct tgacaggatc actgggagtt gtcgacttgc ccgtgatggc gagcctctcc       540
     cccaccggtg gtattaatgg ccgatacaga cgctatgaga tgatgagaat tcaaggatca       600
     gtccggactc tgaagagccc acgagggcgc aagttcgaca tcgacgccgg agaaattgtt       660
     tggtcgctgg aggagaacaa tttgcagaga tcgggcctgc cgcgggagtt cacctttgcc       720
     atgctgatcc agaaaccgcg cgcagacagc cgcattgttt tctccttgga catcgagccc       780
     accctacagt cgtggtacgg cagctaccct gactggtggt tatctttgcc taagtatcag       840
     cctcagagtc gacggccggt ggactttaga tcagaggtcg gtcagcgctt tgagcccgcc       900
     gaatcaaaga aagggttcaa tttcgcgact cttgaaagct ctttcgatga ctatatccca       960
     tctgacggag gagtgctgca agacgacaac gacacccttc aagacaccaa ccatgaccgc      1020
     accatagtcg agccaatacg gggggtcgcg agattagcat atcccaatac cctcgccggc      1080
     gcagcagcaa cagcaacctc agcaccagcg cctggcgagc cggccctcat cgcacgccgc      1140
     ggaaccctcg gctcagaccg gagcgccctg accatccacc tcctgatgga caaccagatg      1200
     ccttcgcccc tgtcaagtct gcgcgggagc cgaccctcac ccaaactcac cagccatagc      1260
     aacattcatg gcaatagcgc taccaagcag gataaagctg atcgccgaga gtcccctagg      1320
     gcactgccag cagccaccat cccagcaccg cctcagcgcc agacaaccct ccgtaggaca      1380
     agatcgcgag agggactaaa tcgaaatctg aatttggatc atcatcatca tccgaaaccg      1440
     cgtccccaag tatccgaccg gcgttttaac tga                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page