(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE330

ASFUM1_6.PE330       Location/Qualifiers
FT   CDS_pept        complement(1026792..1028234)
FT                   /codon_start=1
FT                   /gene_family="HOG000201038" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207945"
FT                   /orf_name="AFUA_6G04490"
FT                   /product="Camp independent regulatory protein "
FT                   /protein_id="EAL85591.1"
FT                   /db_xref="HOGENOM:HBG056195"
FT                   /db_xref="HOGENOM:HBG327822"
FT                   /db_xref="InterPro:IPR018608"
FT                   /db_xref="UniParc:UPI000051E5BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDE7"
FT                   /transl_table=1
FT                   /translation="MVNGTAAVLEPTFTGYVATTQDALILFEACLTGILHHVPRRPHDR
FT                   ERSHLVRSGSVFIYEENSSGIKRWTDGVTWSPSRILGNFLVYRELEKPFPPGEKKRAMK
FT                   KANRRPVPSARPGEPYPRHDSNGGSYSPSSTSGSFGDRSHQSDVERALVGSLVDSYGFK
FT                   DSGLVKKTMSVTVSGVTHHLVSYYSVEDVMRGVLNPPSMVESLRYIRPRAELTQKQSFR
FT                   APIDDLETGGLENPNDPSHAIYGYRPQLMAPPGYAMPNPHPEFYLHTAPYTASHAPQSA
FT                   PIPGYSIGSSMPAQPAPNPYLPAPSAPAHVQQKTEDYPQYRNPNPAPSAYGTSFDSISH
FT                   APLSSSMPSTLNSSIPSSLSERNRSTSDQSVSAYRNSSISSRSVATDVTSPIDPSTPAT
FT                   FSRGNSFSLSGHMDGPSQQPPEQRGIAPAFDPSIPRRESIPAHYYAGSDRPQYYMGATA
FT                   PAAHASYPVSTWTTAAPAQPQM"
     atggtgaacg gcaccgctgc ggtgttggaa cccacgttca ctgggtatgt cgcaacgacg        60
     caagatgcac tgatcttgtt cgaggcctgc ttgacgggca tcctacatca cgttcctcgt       120
     cgacctcatg atcgcgaaag gagccatctc gtccgcagtg gcagtgtgtt tatctacgaa       180
     gagaactcgt cagggatcaa gcgatggaca gatggagtta cgtggagtcc cagtcgcatc       240
     ttgggcaact ttctagtcta ccgtgagctt gaaaagccgt tcccaccagg agaaaagaaa       300
     cgagcaatga agaaggccaa ccgacgtccg gtgccgtctg cgaggcctgg cgaaccctac       360
     ccgcgtcacg atagcaacgg tggatcttat tctccctcgt cgacatctgg gtcgtttggc       420
     gatcgatcgc atcagtcgga cgtggaacgc gcactggtcg gttccttggt ggattcatac       480
     ggcttcaagg attcggggct ggtcaagaag acaatgagcg taactgtctc tggggtgact       540
     caccacctgg tgtcgtatta cagcgtcgaa gatgtgatgc ggggcgttct gaatccgccg       600
     tccatggtgg aatcgctgcg atatatccgc ccacgcgcgg aactgacgca gaagcagagc       660
     ttccgcgctc caatcgatga tctggagaca ggtgggcttg agaatccgaa tgatccatcc       720
     catgccattt acggatatcg gccacagctg atggcgcctc ctggatacgc catgccgaat       780
     ccccaccctg agttttatct gcatacggcg ccttacactg cctctcacgc accacagtct       840
     gcaccaatcc ccggatattc cattggaagc tcgatgcccg cacagcccgc accaaatccg       900
     taccttcccg ccccttctgc acccgcgcat gttcagcaga agacggagga ctatccgcag       960
     tacagaaatc ccaacccagc tccaagtgcg tatgggacca gttttgactc catcagccat      1020
     gcgccattgt cttcatccat gccttccacc ctgaacagca gtatacctag ttctctaagc      1080
     gagcgcaatc gctctacatc ggatcaaagt gtgtcggctt accgaaactc ctcgatctcg      1140
     tcgcgcagtg ttgccacgga cgtgacatcg ccaatcgatc cttccacccc agcgaccttc      1200
     tctcgaggga acagttttag tctctcgggc cacatggatg ggccatcgca acaaccaccc      1260
     gagcagcgtg gcattgcgcc agcgttcgat cctagtatcc ctcgtcggga gtctatacca      1320
     gctcattact atgcaggaag cgacaggcct cagtattaca tgggagcgac ggcgccggcc      1380
     gcacatgcga gttaccctgt ctcgacatgg accacggctg ctccagctca gccgcaaatg      1440
     taa                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page