(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE331

ASFUM1_6.PE331       Location/Qualifiers
FT   CDS_pept        join(1041982..1042736,1042948..1043584)
FT                   /codon_start=1
FT                   /gene_family="HOG000201141" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751319"
FT                   /orf_name="AFUA_6G04500"
FT                   /product="Snf1 kinase complex beta-subunit Gal83, putative "
FT                   /function="kinase activity"
FT                   /protein_id="EAL85590.1"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG056194"
FT                   /db_xref="HOGENOM:HBG328305"
FT                   /db_xref="InterPro:IPR006828"
FT                   /db_xref="UniParc:UPI000051F196"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDE8"
FT                   /transl_table=1
FT                   /translation="MGNNPSKGPSGDAPPSSASSNLSAPAGDKKVNRRPSTNAISGAAK
FT                   ATAADPSASIETATGHSATARQTPVQQRLQSRNITDSSRGNSERHDRHDAKKAEPHYRD
FT                   IPSPDPSNPVQVPVSRAAARNDATVAPSGPPLNTYYSASTHLQRPPRMPLPIGDATATP
FT                   GSPIIGPEDSHIGFVSGDRSLGEQASQDNAGITNTAIDDEETLDELEPYTPSGVGRAVP
FT                   TCIEWNGPGEKVYVTGTFVNWEKKYRLHRNESNPGVMSTTLNLRPGTHHLKFIVDGEMR
FT                   ASDNLPTAVDFTNHLVNYIEVSADDVNQSRRGSDRTNKSAVPSGVHPPQVIPNLIGDDR
FT                   NGVENQSDKEEPEEIPLGDFQTIIPQFLVDLDKDEDSPEYQQAANVIGDTPTPPSLPLF
FT                   LGKSILNGTTPMKDDSSVLNYPNHTVLNHLATSSIKNGVLATSVTTRYKRKVRSPPNST
FT                   TFVRV"
     atgggcaaca atccttcaaa gggcccttcc ggagatgctc cgccaagttc ggcctcatca        60
     aatttatcgg ctcccgcagg cgataagaag gtgaatcgcc ggccgtcaac caacgcaata       120
     tccggggcag caaaggcaac tgcggccgac ccctcggcat ctattgagac agcaacagga       180
     cattcggcca cggcacgtca aactccagtt cagcagcgcc ttcaatcgcg caatattaca       240
     gactcttcta ggggtaattc cgagcgacac gaccgacatg atgcaaagaa agcagagcct       300
     cactacaggg atattccctc accggatcct tcgaatcctg tgcaagtacc agtttctcgg       360
     gctgctgcca gaaatgatgc gactgtagca ccgtctggcc cacctctcaa cacatattat       420
     agtgcttcca cccaccttca acgtccgcct cggatgcccc tacccatcgg cgatgcaacc       480
     gctactccag gttcaccgat catcggacca gaggactccc atatcggttt tgtctcgggc       540
     gaccgttcat tgggcgaaca agcaagtcaa gacaatgcag gcatcaccaa tactgccatt       600
     gacgatgagg agacgcttga cgagctcgaa ccatataccc cgagcggtgt aggcagggct       660
     gtaccaacat gtatcgaatg gaatggccct ggagaaaaag tatacgttac tggtaccttt       720
     gtgaactggg aaaagaaata tcgtcttcac agaaatgaaa gtaatccagg ggtcatgtcc       780
     acaacgttaa atctccgtcc tggcacacac catctgaagt ttattgtgga tggggaaatg       840
     cgggcttcag ataatctgcc gactgcagtc gattttacga atcatctcgt caactacatt       900
     gaggtcagcg cggacgacgt caaccaatcg cgcaggggga gtgatagaac gaacaaaagt       960
     gcagttcctt caggggttca tcctccccag gttattccca atcttattgg ggacgaccgc      1020
     aatggtgtcg aaaatcagtc ggacaaggaa gaaccagagg agattccctt gggagacttt      1080
     cagactatca tcccccaatt tcttgtcgat cttgacaagg atgaagacag tccagaatac      1140
     cagcaagccg ctaatgtgat tggtgatact cctacgcccc caagtcttcc acttttcttg      1200
     ggtaaatcga tcctcaacgg cacgacgccg atgaaagatg acagcagtgt tctcaactat      1260
     cctaatcata cagtactcaa tcatctcgcg acgagtagca tcaaaaatgg cgttctggca      1320
     accagtgtga ctaccagata caaaagaaag gtaagatctc cgccaaattc caccacattt      1380
     gtcagagtat ag                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page