(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE334

ASFUM1_6.PE334       Location/Qualifiers
FT   CDS_pept        join(complement(1050030..1050170),
FT                   complement(1049409..1049891),complement(1048231..1049355))
FT                   /codon_start=1
FT                   /gene_family="HOG000201163" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265329"
FT                   /gene_name="epl1"
FT                   /orf_name="AFUA_6G04530"
FT                   /product="Enhancer of polycomb-like protein 1 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="cell cycle"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85587.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG056193"
FT                   /db_xref="HOGENOM:HBG328303"
FT                   /db_xref="InterPro:IPR019542"
FT                   /db_xref="UniParc:UPI000051E830"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDF1"
FT                   /transl_table=1
FT                   /translation="MGRTRPKKLTSKASIPIVREHEIDIIDDEVQNALQQVETGVEKAE
FT                   ESEFHLQAAISATAQGKVNEAHIPTPETVLSNLRYDELYPPIFSQPATYIRFSSTIEDC
FT                   CGCPYNMTEEDDVFFKIMNEKREPSNRITEDQFEEVMYFFEETAQTKQPFAAVDSPPVL
FT                   SFAEMQDSMDATVEESVKCFAKDIYEHWKLRRIATGNRPLLPSLKFETGQDTDDTDPYV
FT                   CFRRREVRQIRKTRGRDAQSADKLRRLRKELEDARQLVALVRQRELARKEMLSMERQIF
FT                   LQRSEVKEMKRKLNIKDDDEDLINQKVTSIPARLPHAFANLPEQPKKKPAEAPAAQRPT
FT                   APQIRMPQKPGTQAADDMQLLEDVQAEKENEILRDIKQNIAKHIKWNEGYVDYTRAPLS
FT                   PPPEKTFQAAFRPAITTQLPTPPSSDSSDNMMLESALDTANSLSFRDKLVPRTWEMNED
FT                   TCRIPSFRRRIGRGGRLMIDRRNMASRCRIEMDPLKADRFKYDREDSDDESEFECDPYD
FT                   VQIMQHRAIMAAKARDQAAAAAQAHAQAQAQKRLQAEQTTTNNGPPNIGHTMGSNPGPG
FT                   AVASTS"
     atggggagga cgcgcccgaa aaagctcacc tcgaaggcct caatccccat tgtccgggaa        60
     catgagatcg atatcatcga tgatgaggtc cagaatgccc tacaacaggt ggaaactggt       120
     gtcgagaagg ctgaggagtc ggagttccat cttcaagctg ctatcagcgc gactgcccaa       180
     ggaaaagtaa atgaagctca cattcccaca ccagaaaccg tcctcagtaa tcttcgatat       240
     gacgagctct atccccccat cttctcacag ccggcgacat acatccgctt ctcgtcgact       300
     atcgaggact gttgcggatg cccgtataac atgaccgaag aggatgatgt cttcttcaag       360
     atcatgaacg agaagcggga gccgtcgaac aggataacag aggatcagtt cgaggaggtg       420
     atgtacttct tcgaggagac ggcacagaca aagcaaccct ttgcagctgt agatagccct       480
     cctgtcctga gcttcgcaga aatgcaagac tcgatggatg caactgtaga ggagagcgtc       540
     aagtgttttg caaaggacat atatgagcac tggaagttgc gaaggattgc tactgggaac       600
     cgcccactcc taccgagtct caagtttgaa actggtcaag ataccgatga tacagacccg       660
     tatgtctgct ttcgtaggcg tgaagtccgt cagattcgga agacccgcgg cagagatgcc       720
     caaagtgccg acaaactgcg cagactcaga aaggagctgg aagatgctcg acagctggtt       780
     gcactggtgc gccagcggga gttggcaaga aaagagatgc tctcgatgga gcggcagata       840
     ttcctgcaac gttccgaggt gaaggagatg aagaggaaac tcaacatcaa agacgatgac       900
     gaggatctca tcaaccagaa ggtaacgtca ataccagcac gacttcctca tgcgtttgct       960
     aacctgccgg agcagccaaa gaagaagcct gcggaggcgc cagctgcaca acgaccgacc      1020
     gctcctcaga tccggatgcc acagaagccc ggtactcagg ctgcggacga catgcaattg      1080
     ctggaagacg tccaggcgga gaaagaaaac gagattctgc gagatatcaa gcagaacatc      1140
     gcgaagcata tcaagtggaa cgagggctat gtggattaca caagagcgcc tctctcgcca      1200
     cctccagaga agaccttcca ggccgctttc cgcccagcaa tcaccaccca gttgccaact      1260
     cctccttctt cagattcgtc tgacaatatg atgttggagt ctgccttaga tacagccaat      1320
     tccctctcct tccgagataa gctagtccct cgtacatggg agatgaacga ggacacctgc      1380
     agaataccgt cgttcagaag gcgcattgga cgtggtggtc ggttgatgat tgatcgtcga      1440
     aacatggcgt cgcggtgtag aatcgagatg gatccgctga aggctgatcg attcaagtat      1500
     gatcgggagg attcagacga tgagtcagaa ttcgaatgcg atccgtacga tgttcagatc      1560
     atgcaacatc gtgccataat ggccgccaaa gcacgagatc aagctgctgc tgccgcccaa      1620
     gcacatgcgc aggctcaagc gcagaaacgg ttgcaggccg aacaaaccac aaccaataac      1680
     gggcccccga acatagggca cacaatggga tcgaaccccg ggcctggtgc cgtcgcctcc      1740
     acttcgtga                                                              1749
//

If you have problems or comments...

PBIL Back to PBIL home page