(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE336

ASFUM1_6.PE336       Location/Qualifiers
FT   CDS_pept        join(complement(1054459..1055113),
FT                   complement(1053950..1054216),complement(1053777..1053871))
FT                   /codon_start=1
FT                   /gene_family="HOG000201174" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056656"
FT                   /orf_name="AFUA_6G04550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85585.1"
FT                   /db_xref="HOGENOM:HBG056192"
FT                   /db_xref="HOGENOM:HBG328297"
FT                   /db_xref="UniParc:UPI000051E829"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF3"
FT                   /transl_table=1
FT                   /translation="MEYGYTDTAFQDDPLHGDELQPYPTTLREQQRQQSIQQPFAAYES
FT                   EMVYNLGQQGPTQNPYEVVPQYPARQSAAIDALSSQFAVPQYFPTNEPMATGVPAEVSP
FT                   YLNPQVSPSAYNQARPIGRSSAMQPFPATMAEFTPVGATARRLEQQETSQQQQHHSQQQ
FT                   QQHVIPDSTNLNEEYGRFQRVLRSTFDHIRAGRLVEAGRSLLEISEWLVTNARELGILS
FT                   DEPMFYSDRLQLWNNFNICWLAVCQKQKDMTLELLGAGHQPSNTSMLSSDRLDEMGRKL
FT                   IQLCDQMEQHGLVDYQMGIWEEEILCVLGECIDLIESRPSNMRAHGVNAAAAATSRS"
     atggagtatg gatacacaga cactgctttt caggatgatc ccttgcacgg ggacgaatta        60
     caaccgtatc ctacgacgtt gcgcgaacag cagcgccagc agtcgataca gcaacccttc       120
     gccgcttatg aatcggagat ggtatataat ctcggtcagc aaggtccgac acaaaatccg       180
     tacgaggtcg tgccacagta cccagcacgg caatctgcag cgattgatgc cctgtccagc       240
     caatttgccg ttccacagta ctttccaact aatgagccga tggcaacagg ggtccctgca       300
     gaggtttcgc cctacctgaa tccgcaagtc tctccatctg cttataacca ggcccgtccc       360
     attgggcgct cgagcgcaat gcagcccttt cccgcaacta tggccgagtt tacccctgtg       420
     ggggcaacgg cacgacgttt ggagcaacaa gaaacgtccc agcagcagca acatcattca       480
     cagcaacaac agcagcatgt aattccggat tcgacaaatc tcaatgaaga atatggtcgg       540
     tttcaacgag tcttgcggtc gacgttcgat cacattcgcg ccggtcgatt ggtagaggcc       600
     gggcgatcac tcttggaaat ttccgagtgg cttgtcacta atgcgcggga acttggcatt       660
     ttaagcgacg agccgatgtt ctattctgat cggttacagt tatggaataa cttcaacatc       720
     tgctggttgg ctgtctgcca aaaacagaaa gatatgacgc tggagctgtt gggggccggc       780
     catcagccgt cgaacacatc aatgctcagt agcgatcgtt tggacgagat gggcagaaaa       840
     ctgattcagc tatgcgatca gatggagcag catggactgg tggactatca gatgggcatt       900
     tgggaggagg agatactctg tgtccttggg gaatgtatcg atctaataga aagtcgacca       960
     agtaacatgc gggcacatgg agtgaacgcc gccgcagccg ctacttcgcg gtcctga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page