(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE338

ASFUM1_6.PE338       Location/Qualifiers
FT   CDS_pept        join(1060589..1060825,1060939..1061140,1061387..1062109,
FT                   1062166..1062452)
FT                   /codon_start=1
FT                   /gene_family="HOG000201196" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265330"
FT                   /orf_name="AFUA_6G04570"
FT                   /product="Translation elongation factor eEF-1 subunit
FT                   gamma, putative"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="eukaryotic translation elongation
FT                   factor 1 complex"
FT                   /protein_id="EAL85583.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005853"
FT                   /db_xref="HOGENOM:HBG020891"
FT                   /db_xref="HOGENOM:HBG436026"
FT                   /db_xref="InterPro:IPR001662"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000052045C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF5"
FT                   /transl_table=1
FT                   /translation="MAYHVSYQTLLRSPTPSRDSHKISSIFFHQSPSGISFFFLFEHLL
FT                   LSQPPPPSSFPFSPTSPHPHLTFTMAFGKLYGLPENGRTIAALVAAKCNDLELELVKTE
FT                   ANSAAAFNQSAEYQKLSPLGKIPAFEGANGFTLSESIAIAVYVTSQNEKTTLLGKTKQD
FT                   YAAILRWLSFVNAEVLPKLGAWYRPLLGLDPYNKKNVEDAVKAANKALAVLEKHLTANT
FT                   YLVGERITLADYFGASLLTRAFATVLDKAWRSENVAVTRWYNTIINQAPFKAVVPSPVF
FT                   AEEAIKYTPPKKEEKPKAAPAPAKAAAPAAEPEAQPEKKPKHPLEALGKPEFVLDEWKR
FT                   QYSNEDTRPVALPWFWQNYKPEEYSLYAVDYKYNNELKLTFMANNLIGGFHARLEASRK
FT                   YLFGAQSVYGENYNCVIRGVFLVRGQDWKPAFEVAPDWESYDFRKLDPSNPEDKKLVED
FT                   MWAWDTSVTVDGKEYPHVDGHVFK"
     atggcatatc acgtgagcta ccaaacgtta ctccggtcgc cgacgccgag tcgtgattcg        60
     cacaaaattt cgtcgatctt tttccaccag agcccctcag gtatcagctt ttttttttta       120
     tttgagcatc ttctcctttc ccaaccccct cctccctcct cttttccttt ctctcccaca       180
     tctccccatc cacacctcac gttcacaatg gctttcggaa agctttacgg tcttcctgag       240
     aacggtcgta ccatcgccgc cctcgtcgct gccaagtgca atgacttgga gctcgagctg       300
     gttaagactg aggccaactc tgctgctgcc ttcaaccagt ctgctgagta ccagaagctc       360
     agccccctcg gcaagatccc tgctttcgag ggtgccaatg gcttcactct ctccgagtcc       420
     atcgccatcg ctgtgtacgt gacctcccag aacgaaaaga ctactctcct gggcaagacc       480
     aagcaggact acgctgccat cctccgctgg ctctcgttcg tcaacgctga ggtcctcccc       540
     aagctcggtg cctggtaccg ccctctgctg ggccttgacc cctacaacaa gaagaacgtt       600
     gaagatgccg tcaaggctgc caacaaggcc ctcgccgtcc ttgagaagca cctcactgcc       660
     aatacctacc tggttggtga gcgcatcacc ctcgccgatt acttcggtgc ctctctcctc       720
     acccgcgctt tcgctaccgt tttggacaag gcttggcgct ccgagaacgt tgccgtcacc       780
     agatggtaca acaccatcat caaccaggct cctttcaagg ccgtcgtccc cagccctgtc       840
     ttcgctgagg aggctatcaa gtacactcct cccaagaagg aggagaagcc caaggctgct       900
     cctgctcctg ccaaggctgc tgctcctgct gctgagcccg aggcccagcc tgagaagaag       960
     cccaagcacc ctcttgaggc tcttggtaag cccgagtttg tccttgatga gtggaagcgt      1020
     cagtactcca acgaggacac ccgccccgtt gctctgccct ggttctggca gaactacaag      1080
     ccggaagagt actctctcta tgctgttgac tacaagtaca acaacgagct caagctcacc      1140
     ttcatggcta acaacctgat cggtggtttc cacgcccgtc ttgaggcttc ccgcaagtac      1200
     ctcttcggtg ctcagtccgt ttacggcgag aactacaact gcgttatccg cggtgtcttc      1260
     cttgtccgtg gtcaggattg gaagcccgcc tttgaggtcg cccctgactg ggagagctac      1320
     gacttccgca agctcgaccc ctccaacccc gaggacaaga agctcgtcga ggacatgtgg      1380
     gcctgggaca cctccgtcac tgtcgatggc aaggagtacc cccacgttga tggtcacgtc      1440
     ttcaaatag                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page