(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE339

ASFUM1_6.PE339       Location/Qualifiers
FT   CDS_pept        complement(1063069..1064946)
FT                   /codon_start=1
FT                   /gene_family="HOG000201197" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056657"
FT                   /orf_name="AFUA_6G04580"
FT                   /product="NIF domain protein"
FT                   /protein_id="EAL85582.1"
FT                   /db_xref="HOGENOM:HBG056191"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00005206C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF6"
FT                   /transl_table=1
FT                   /translation="MTRLKATRDGILQAGHHPQNDHGLRDPSQNSSKTWRPYQGRWDPN
FT                   NPGWRSATAIPSRSDNAVSSGSRKNGTRRNARFFDRMSKGEPSPYTPHLSGSQQAQVPH
FT                   IQLQQPFNAPSATPQLDPNVNSFPVLPMNSNTSDTSNNTTMQLPFLPLHVPHSQSAQSQ
FT                   ILPNNLSFTPYGFPPMPDLNSPEKILPFMPSVAPFPPLNLSVFSPALAPPVFGGFPFCP
FT                   FDPMYPTTVGPTGGSSQGPTLQPLLPIPPRDRRSKTPEPPVPTKEYLTQSLLAPKLNPS
FT                   RQPLLVILDLNGTLIFRKHRRLPPSFAKRTGLDQFLDTLLKNYKVMIWSSSQPETVNAV
FT                   CEKLFPGEKRKSLVAEWGRDKLNLSRSQYRSKVQVYKTLETVWSNQEIQASYPISHQNG
FT                   RFKTKKKAAQGKSRWDQTNTVLIDDSKLKALSEPYNILEIPEFTNAPGIDESHIFPKVL
FT                   ECLDSLAQHDDVSKLLHLWNSKLATNITTNSTILDLDIGVIQSPQRQNGSSLITPSTPQ
FT                   EIAQARKERRRARKQEKKAARRAAAAIGNAPANVPTSAAVSAITAEGINDGVTAVDSTP
FT                   ATSGDDSAILTATAVPQSHTRHSPSPVSSVQSENYLLDRLEESLNVRRD"
     atgacacgat taaaagctac tagggatggt atacttcaag caggacatca tccacagaac        60
     gatcatggtc tacgtgatcc aagccagaat tcaagcaaaa catggaggcc atatcaaggt       120
     cgttgggatc caaacaaccc cggttggcgc tccgcgacag cgattccttc cagatctgac       180
     aatgctgtgt cgagcggttc gcggaagaat ggtacacgac gtaatgccag attctttgac       240
     agaatgtcaa aaggagaacc gtcaccgtat actccacatc tgtcaggctc tcaacaggct       300
     caagttccgc acatacaact acagcagccc ttcaatgcgc cgtctgctac tccgcaactt       360
     gaccctaatg tcaactcgtt tcccgttttg cctatgaatt caaatacatc agacacttca       420
     aacaacacga ctatgcagct gccgtttctc ccgttacacg taccacattc acaatcggca       480
     caatcgcaga ttttgcccaa taacctctcg ttcacccctt acggttttcc gccaatgcca       540
     gacttgaata gccccgaaaa gatactgcct ttcatgcctt cagtggcccc attccctccc       600
     ctaaacttga gtgttttcag tccagcattg gcaccaccag ttttcggcgg atttccgttc       660
     tgtcccttcg acccgatgta ccctacaaca gttggcccta ctggaggcag ttctcagggc       720
     ccaacactgc aaccgttgct cccaatccct ccgcgtgatc ggcggtctaa aaccccggag       780
     cctcctgtgc cgactaagga atatctgacg caatcattat tggccccgaa actaaatcct       840
     agccgccagc ctctactagt cattcttgac ctgaacggca ctctgatctt tcgaaagcat       900
     cgacgtctcc ccccttcttt cgccaaaagg acaggcctgg accagttctt ggacactttg       960
     ttgaaaaact acaaagtcat gatctggtcc agttcgcaac cagagacggt aaacgcggtt      1020
     tgcgagaaac tgtttcctgg agagaaaagg aagtcactgg tagctgagtg gggccgcgat      1080
     aagttgaatc tttcgagatc tcagtacagg tcaaaggtgc aggtctataa gaccttagag      1140
     acagtatgga gcaatcaaga gattcaagcc tcgtatccca tctcccatca gaacggtcgg      1200
     tttaaaacga agaaaaaggc ggcgcaggga aaatcgcgct gggaccagac gaacaccgtc      1260
     ctcatcgatg acagcaaact caaagcactc agcgagccct acaacatcct cgaaatcccg      1320
     gagttcacga acgctccagg tatcgacgag tctcacatat tccccaaagt ccttgaatgc      1380
     cttgactccc tagcgcagca cgacgatgtc agcaagttgc tccacctctg gaactcgaag      1440
     ctcgcgacaa acatcacgac gaacagcaca attcttgatc ttgacatcgg agtaatacag      1500
     tctccacagc gacaaaacgg aagttcttta atcacaccct caacacccca ggaaatagcc      1560
     caggcgcgca aggaacgtcg aagagctcgc aaacaggaga agaaagcggc ccgacgggct      1620
     gcggccgcta tcggcaacgc acctgcgaat gtacctactt ccgctgctgt ttctgccata      1680
     acagctgaag ggatcaatga tggggttact gcggttgaca gcaccccagc aacatcaggt      1740
     gacgacagtg ctattttgac agctacagct gtgccgcaat cgcataccag gcattctccg      1800
     tctcccgttt cctcagtgca atcggaaaac taccttctcg atcgcctaga agagtcgttg      1860
     aatgttcgcc gcgactga                                                    1878
//

If you have problems or comments...

PBIL Back to PBIL home page