(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE34

ASFUM1_6.PE34        Location/Qualifiers
FT   CDS_pept        join(complement(118487..118698),complement(118095..118439),
FT                   complement(117859..118051))
FT                   /codon_start=1
FT                   /gene_family="HOG000202856" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262218"
FT                   /orf_name="AFUA_6G00460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84219.1"
FT                   /db_xref="HOGENOM:HBG056311"
FT                   /db_xref="HOGENOM:HBG329537"
FT                   /db_xref="UniParc:UPI000051EFEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W900"
FT                   /transl_table=1
FT                   /translation="MPHFELAHKVRHLIVQPADQRQNPPESYLFVQDGLIISCGVLYAL
FT                   CYIFCIIRVYSDRTYPGARWGSIQFLCLTMAYEIFYAFTTTSTRFEMLAFLAWFELDLS
FT                   FAIVALRKAHAPAERRFLRRNMVLGCLTGIAFLWTLTRRYPDEREQVTAYWTGIILQLP
FT                   IGWICLYQLWEDHSTQGHSLEIWLTRYLGCFTAYGVFLWRYFNVPQNWRYVWTPWSIGI
FT                   IIATLIPETVYPIVYLWVHKTQKDKRA"
     atgcctcatt tcgagctcgc acacaaggtt cggcatctta tcgttcagcc cgccgaccag        60
     cgacagaacc ctcccgagag ttacctcttc gtccaagatg gcctcatcat cagctgcggt       120
     gtgctctatg cactctgcta catattctgc ataatacgag tctattccga taggacctac       180
     ccaggtgctc gctggggaag tatccagttt ctctgtttga caatggcgta tgagatcttc       240
     tacgccttca caactacgtc tactcgcttt gagatgctgg cgtttttggc ttggtttgag       300
     ctggatctga gctttgcgat tgttgcgctt cggaaggcgc atgccccggc tgagagacgg       360
     ttcctccgtc ggaacatggt cctgggctgt ctgacgggaa tagcgttcct ctggacgctg       420
     actcggagat atcccgatga acgggagcag gtcactgcgt attggaccgg tatcatcctg       480
     cagcttccca ttgggtggat atgcctgtat caattgtggg aggatcatag cacccagggt       540
     cattccctcg aaatatggct cacgaggtac ttgggctgct ttactgccta tggagtcttc       600
     ctctggcgat acttcaatgt ccctcagaac tggagatatg tctggacacc ctggagcatt       660
     gggattatta ttgccactct cattccagag acggtctacc caattgttta tctgtgggtg       720
     cacaagacgc aaaaggataa gagggcatag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page