(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE344

ASFUM1_6.PE344       Location/Qualifiers
FT   CDS_pept        join(1076782..1077069,1077143..1077292,1077369..1077503)
FT                   /codon_start=1
FT                   /gene_family="HOG000048638" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207948"
FT                   /gene_name="loc1"
FT                   /orf_name="AFUA_6G04630"
FT                   /product="60S ribosomal subunit assembly/export protein
FT                   loc1"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="EAL85577.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG059879"
FT                   /db_xref="HOGENOM:HBG328239"
FT                   /db_xref="UniParc:UPI00005206C3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDG1"
FT                   /transl_table=1
FT                   /translation="MAPNKPSVKGKSSSKGDSGKSKPLSSASKVSKKHAKRPPPKEVKS
FT                   KARTESSLLKKTKKREYTEEELGLPKLNMITPVGVVKPKGKKKGKVFVDDQEGMMTILA
FT                   MVNAEQEGHIESKLQKARQLEEIREAKRKEAEARHAEKKNKLEEAKQSIRQKRKRKSSG
FT                   NEDSKSDASTSKSSSKSKEKRKSVSFA"
     atggcgccga ataagccttc agtcaaaggc aagtcatcct ccaagggtga ctcagggaag        60
     agcaagcctc tctcatccgc ttcgaaagtg agcaagaaac atgcaaagcg cccgccaccc       120
     aaggaagtga agtcaaaggc acgcacggag tcatcactat tgaagaagac aaagaagagg       180
     gaatatacag aagaagaact tggcctcccg aagctgaaca tgatcacacc tgttggagta       240
     gtgaagccga agggcaaaaa gaagggaaag gtttttgttg atgatcagga gggaatgatg       300
     accattcttg ctatggtcaa tgccgaacaa gagggccaca ttgagtctaa gctgcagaag       360
     gcgcgccaat tagaggagat tcgtgaagcc aagagaaagg aagcagaagc gagacacgcg       420
     gaaaagaaga acaagttgga agaagctaaa caatcaattc gccagaagcg caagcggaag       480
     agcagtggca atgaagactc caaatctgat gcttcaactt ccaaatcaag ttcaaagtca       540
     aaagaaaaga gaaagagtgt ttcttttgct tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page