(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE346

ASFUM1_6.PE346       Location/Qualifiers
FT   CDS_pept        join(1082291..1083253,1083338..1083448,1083603..1083718,
FT                   1083767..1084419,1084472..1085313)
FT                   /codon_start=1
FT                   /gene_family="HOG000200950" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265334"
FT                   /orf_name="AFUA_6G04650"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="EAL85575.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG056188"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019440"
FT                   /db_xref="UniParc:UPI000051ECAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG3"
FT                   /transl_table=1
FT                   /translation="MNYPPSHNGQYPPQYLQQPQQLLYNNADSNVSPYEYGKPVAYPQT
FT                   IISPYSSYGQAYNIEQHQHQPQSHHQQQPPQQQPQQQYVNPSDVFHQPLLPPASSSQLA
FT                   HGSTQYGAQPMVSVAGNSNRSPAVASASTSAQSTPAPSTQSAYQTAPTLNPRNNVFNQY
FT                   SQVALPAPSVPSSNSVATAPSVPSPKPALPLSSKSADSVPSLRPAPPVPSASKPAPPVQ
FT                   AKKPLPQVLVPAPSPEVQQKMQRQGSKKQVQRQNAPQAVQKPTKLPIDYQVLLLSLADE
FT                   YLKAAYGQGTMVALSRREMEIEEYYKLVATGLGCLEAVLKNWRLQPRMEALVRLRYARI
FT                   LFEETENDLEAETALSKGNRMLDLKYSMQHLLARMLHKTNPKASLKAVDGMILDVEAYR
FT                   HSAWEYAFRFLRVSLSLSTSAHQDSVSALQHLHKISNMANRQGDKAVAAISAVIEALAH
FT                   LQQGTSSDAIEQAQRAVAVARSHQLNDELRHIPQLSTLVQMVDICCSLLEYDVNQSSQK
FT                   LKVMQDLMDERLNDPNWRADGSFSIPLSGRSAGPSSIDTGDILQVQNGTLLLSFNWLPQ
FT                   HDLYALCYFLSSITLSAKNSYDGRKAEKFLQEGIRMVKGSFKAPQEIVESMVNANRRVG
FT                   WRRILYCNLLLHQVFLACGRTDWDLANQTLKELRSIAEELGDQLPDTIQRLMEYATGAL
FT                   AQATGDLEAALSIFQSPLLSLSSITSKTARNDPRRDIAILAALNTILILRDPNHPSHSN
FT                   LPSALALVESFCKASPNKYIQAAYYLVCATVQTESTIQTKQYLQQALQSATAISNSQIT
FT                   CMTLTFMSWKYFRGVVGEQAEKSARAGRAMAKKANDRLWVSVTDEMLAETLERQGKSEE
FT                   AEGVRDEGHRVMTGLPPALKRPV"
     atgaactacc caccatctca taacggtcaa tatcctccgc agtatttgca acaaccgcag        60
     cagctactgt ataacaatgc cgactcaaac gtttcgccat atgagtatgg caaacctgtc       120
     gcttaccccc agactattat ttcgccatac tcgtcctacg ggcaagcata taatatagag       180
     cagcatcaac atcaaccaca atcgcaccac caacagcagc cgccgcaaca gcagccgcaa       240
     cagcaatatg tgaatccatc tgacgtgttc catcaaccgc ttcttccccc tgcctcgtca       300
     tctcaacttg cccatggctc aacccaatat ggtgcccaac ccatggtttc tgttgcaggc       360
     aacagcaacc gttccccagc tgtcgcaagc gcctcaacgt ctgcacaatc aacacccgcg       420
     ccatcgacac aatcggcata tcagacagcc ccaaccctaa acccaaggaa taatgtcttc       480
     aaccagtact ctcaggttgc tcttccagcg ccttcggttc caagttcaaa ttcagtagct       540
     accgctcctt ctgtgccatc cccgaaaccc gcacttcctc tgtcatcgaa atctgccgat       600
     tctgttccat ccttgagacc tgctcctccc gttccgtcgg catcgaaacc cgcgcctccc       660
     gtgcaggcga agaaacccct ccctcaagtc ctggtcccgg ctccttcacc ggaagtccaa       720
     cagaaaatgc agcgccaggg ctctaaaaaa caagtgcaac gacagaacgc tccgcaagct       780
     gtgcaaaagc caaccaagct gcctatagat tatcaagtcc tcttgttgag cttggcagat       840
     gagtatttga aggcagctta tggtcaaggc accatggtcg ctttatcaag gcgggagatg       900
     gaaattgagg aatattacaa gcttgttgcg acaggtcttg gttgcctgga ggcagtatta       960
     aagaattgga ggctacaacc gcgaatggaa gcccttgtaa ggttgcgata tgcgcgcata      1020
     ctatttgagg agacggagaa tgatcttgag gcagaaacag ctctgagcaa agggaatcgc      1080
     atgttagatc tcaaatatag tatgcagcat cttctggcgc ggatgctaca caagaccaac      1140
     ccaaaagcct cattgaaggc tgtcgatggt atgatactgg atgtcgaagc atatcgccat      1200
     tcggcttggg agtatgcttt tcgctttctt cgggtgtcac tttcgttatc aacatcggcg      1260
     caccaggatt ccgtctcggc gctgcaacat ctacataaga tctccaacat ggctaaccga      1320
     caaggcgaca aagctgttgc ggccatctcg gccgtgatag aagcacttgc tcatctgcaa      1380
     caaggaacga gctccgatgc aatcgaacag gctcagcgtg cggttgcagt agcaagaagc      1440
     catcaactca acgatgagct ccgtcatata ccgcaactct caactcttgt gcaaatggtc      1500
     gatatttgtt gcagtctcct tgaatacgac gtcaatcaat catctcagaa attgaaggtc      1560
     atgcaagatt tgatggacga aagattgaat gatccgaatt ggcgtgctga tggctctttc      1620
     tcaattccat tgagtggaag atcagctgga ccctcctcca ttgatacggg cgatattctt      1680
     caagttcaaa atgggacact cttattgagt ttcaattggc ttccccagca cgatctctat      1740
     gcactttgct atttcctcag ctcgatcaca ctcagcgcaa agaactctta cgacggtcgt      1800
     aaggctgaga aatttctaca ggaagggata cgaatggtta aagggagctt caaagcaccg      1860
     caggaaattg tagagtcaat ggtcaatgca aatagacgcg ttggttggcg acggatcctg      1920
     tactgcaatc ttcttctaca tcaggttttt cttgcctgtg gtcggacaga ttgggatctg      1980
     gcgaatcaga cactaaagga gctgcgctcc attgcagagg aactcgggga tcagctccct      2040
     gacaccattc agcgcttgat ggagtatgca acgggcgcac ttgcccaggc gactggtgat      2100
     ctggaggccg ccctttccat tttccagtcc cctcttctct cactatcatc aattaccagc      2160
     aagacagcac gaaatgatcc tcgtcgcgat atcgctatcc ttgccgcctt aaatacgatt      2220
     ctcatactcc gtgacccaaa tcatccgtct cactccaatc ttcccagcgc tttggccctt      2280
     gtcgagtcgt tctgtaaggc tagcccgaac aagtatatcc aggcggctta ttaccttgta      2340
     tgtgcgacag tgcaaacaga gtcaaccatc cagaccaaac agtatcttca gcaggctctt      2400
     caatctgcca cggcaataag caacagtcag atcacctgca tgacgctgac gttcatgagc      2460
     tggaagtatt ttcgcggcgt ggttggggag caagctgaaa agagcgctcg cgcaggccgg      2520
     gcaatggcaa aaaaggccaa tgaccgactt tgggtcagcg tcactgatga aatgctggca      2580
     gagacgttgg aaaggcaagg gaaaagtgaa gaagcagagg gagttcgcga cgagggtcac      2640
     cgcgtgatga ccggattacc accagctctg aaacgacctg tgtga                      2685
//

If you have problems or comments...

PBIL Back to PBIL home page