(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE348

ASFUM1_6.PE348       Location/Qualifiers
FT   CDS_pept        join(1087478..1087666,1087737..1088297)
FT                   /codon_start=1
FT                   /gene_family="HOG000200948" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207949"
FT                   /orf_name="AFUA_6G04670"
FT                   /product="ER-associated proteolytic system protein Der1,
FT                   putative"
FT                   /protein_id="EAL85573.1"
FT                   /db_xref="HOGENOM:HBG268954"
FT                   /db_xref="HOGENOM:HBG435574"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniParc:UPI000051F66C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG5"
FT                   /transl_table=1
FT                   /translation="MAAIWGNGGQGGQFPLEQWFYEMPPVTRWWTVATVATSVLVQCHI
FT                   LTPFQLFYSFRAVYFKSQYWRLLTTFLYFGPLNLDLLFHVFFLQRYSRLLEESSGRSPA
FT                   HFSWLLFYAMTSLLLISPFLSLPFLGTALSSSLVYIWSRRNPDTRLSFLGILVFTAPYL
FT                   PWVLMAFSLVVHGIVPKDEICGIVVGHIWYFFNDVYPSLHGGHRPLDPPRWWRRIFDPR
FT                   AAAGEAQRTDTDNVNRDFAAAAAPEVR"
     atggccgcca tctggggaaa tggtggacag ggcgggcagt tccctttgga gcaatggttc        60
     tacgaaatgc ctccagtcac tcgatggtgg acagttgcga ccgtggctac ttcagtattg       120
     gtgcagtgtc atatcctgac accatttcag ctgttctaca gcttccgcgc agtctacttc       180
     aagtctcagt actggcgact tctcacaaca tttctctact tcggtccatt aaatctcgat       240
     ctactcttcc atgtcttttt ccttcagcgg tactcgcgac tcctcgaaga atcttccggc       300
     cgatcccccg ctcatttttc atggctattg ttctacgcga tgacctctct cctcctcatt       360
     tcaccgtttc tctctcttcc attcctcggc accgccctct cctccagctt ggtgtacatc       420
     tggagccgcc gcaacccaga cactcgactc agtttcctcg gcatattagt cttcactgcg       480
     ccatatcttc cctgggtctt gatggccttc agcttggttg tgcacggcat tgtacctaag       540
     gatgagattt gtggcattgt tgtcggccac atctggtact tctttaatga cgtctacccg       600
     tctcttcacg gcggccatcg ccccttggat ccgccgcgat ggtggaggcg aatctttgat       660
     ccgagagcag cagctggaga ggcacaaaga acagacacgg ataatgtgaa ccgtgatttt       720
     gccgccgcgg ccgcccctga ggtccgatga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page