(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE350

ASFUM1_6.PE350       Location/Qualifiers
FT   CDS_pept        join(1095299..1095641,1095724..1096031)
FT                   /codon_start=1
FT                   /gene_family="HOG000200916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265336"
FT                   /orf_name="AFUA_6G04690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85571.1"
FT                   /db_xref="HOGENOM:HBG056186"
FT                   /db_xref="HOGENOM:HBG328194"
FT                   /db_xref="UniParc:UPI000051F8D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG7"
FT                   /transl_table=1
FT                   /translation="MKPAHLSNSLVFLILPALGYAAPASATTQHQARDVKITATQIETI
FT                   APKSKSCADAPAPGECATSEQAAANIAKSFETYKVTSAAEQAAVIGLMAFESLDFEYNR
FT                   NHFPGVAGQGTRNMQSPAFNAKYAASLPALADKLKDVSGDPAGVLDLLLSNEEYDFGSG
FT                   AWFLTTQCSQDVRSELQSGSQGGWEKYITSCVGTDANEERKAYWMRAVQALGA"
     atgaagcccg ctcatctctc caactctctc gtcttcctca ttctccctgc cctgggctac        60
     gcggctccag cttccgccac cacccagcac caggcccgag acgtgaagat cacagcaacg       120
     cagatcgaga ccatcgcgcc caagtcgaag tcgtgcgcgg acgcacccgc cccgggcgaa       180
     tgcgccacat ccgagcaggc cgcggccaac atcgcaaagt cgtttgagac gtacaaggtg       240
     acctcggctg cagagcaggc ggccgtgata gggttgatgg cctttgagag tttggacttc       300
     gagtacaata ggaaccattt ccctggtgtt gcggggcagg ggacccggaa tatgcaatcg       360
     cctgcattca atgccaagta tgcggcttct ctgccagctc ttgcagacaa gttgaaggac       420
     gtgtctggcg atccggcggg tgtccttgac ttgttgctgt cgaatgagga atatgatttc       480
     ggttccgggg cttggttcct caccacgcag tgctcgcagg acgtgcgctc ggagctccag       540
     tctggttccc agggtgggtg ggagaagtac atcaccagtt gtgtggggac ggatgcaaat       600
     gaggaacgca aagcgtactg gatgcgggcc gtgcaggcgc tgggtgctta g                651
//

If you have problems or comments...

PBIL Back to PBIL home page