(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE355

ASFUM1_6.PE355       Location/Qualifiers
FT   CDS_pept        join(1109697..1109976,1110052..1110579,1110645..1112290)
FT                   /codon_start=1
FT                   /gene_family="HOG000030315" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207950"
FT                   /orf_name="AFUA_6G04730"
FT                   /product="Bifunctional purine biosynthetic protein Ade1,
FT                   putative"
FT                   /EC_number="6.3.4.13"
FT                   /function="ATP binding"
FT                   /function="phosphoribosylamine-glycine ligase activity "
FT                   /function="phosphoribosylformylglycinamidine cyclo-ligase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /biological_process="purine base biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85567.1"
FT                   /db_xref="GO:0004637"
FT                   /db_xref="GO:0004641"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="GO:0009113"
FT                   /db_xref="HOGENOM:HBG019024"
FT                   /db_xref="HOGENOM:HBG328156"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="UniParc:UPI000051EF0D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDH1"
FT                   /transl_table=1
FT                   /translation="MAQEQLRVLVVGNGGREHAYAWKLSQSPLVDVVYVAPGNGGTAQG
FT                   ASSKITNANVKGDDYPALVEFAQKNGVNLVVPGPEAPLVDGIQGYFQAVGIRCFGPSKA
FT                   AARMEGSKTFSKDFMKRHNIPTAAYQNFYEYEPARQYLDSVNHNVVIKADGLAAGKGVI
FT                   IPQTKEEAHKALREMMLDHHFGDAGNEVVIEEYLEGDELSILTFSDGYTIRSLPPAQDH
FT                   KRIFDGDQGPNTGGMGCYAPTPISSKEVLEEIDRTIVQPTIDGMRKDGFPFVGILFTGL
FT                   MMTKDGPKVLEYNVRGGDPETQTLLPLLSADTDLAQIMVACTEHWLDGVDIKIEPKFST
FT                   TVIAVAGGYPGSYAKGKAITLDPAPEDTLIFHAGTKLFGNELQTNGGRVIASTATASTL
FT                   EEALRKSYAGISAIHFEDMFYRKDIAHRAFRQRDAAASQQQQSLTYASAGVSIDAGNDL
FT                   VNKIKSCVARTKRPGTDAVIGGFGGLFSLAAANSAYHPESPTLIGAIDGVGTKLKIAHT
FT                   VGVHNTVGIDLVAMNVNDLVVQGAEPLFFLDCYSCGKLDVETAAAFVAGVADGCVQAGC
FT                   ALIGGETAEMPGLFVDETYDAVGAAVGAINTTGKNAKSILPATSAMQAGDVLLALASSG
FT                   PHSNGYSLVRKIVERSGLSYDDPAPFTMPSSSSESLTLGRALLTPTRIYVKPILKALSI
FT                   PPSNSSSGSSAIKGLAHITGGGLVENVPRMLPSTLSAHIDVSAWQLPPVFSWLKKTGNV
FT                   TAPEMARAFNCGVGMVIVVEKGSEAAVKELFEKEGEVVYQVGELKPRQDGEEGCVLGGL
FT                   QTWDA"
     atggctcaag aacaattgcg cgtccttgtg gtcggcaacg ggggacgcga gcatgcgtat        60
     gcctggaagc tgagccaatc gcccctcgtc gatgtcgtct acgtcgctcc aggcaatggg       120
     ggtactgctc aaggcgcctc tagcaagatt accaacgcca acgttaaggg agacgattac       180
     cctgcccttg tcgagtttgc gcagaaaaat ggtgtcaacc tggtcgttcc tgggcctgag       240
     gcgcctcttg tggacggtat tcagggctat tttcaggcag tcggaattcg atgctttgga       300
     ccttccaagg ctgcagcccg catggaggga tccaagacct tctctaagga cttcatgaag       360
     cgccacaaca tccccaccgc cgcgtatcag aacttctacg aatatgagcc cgcacgtcaa       420
     tatctggact ctgtgaacca caacgttgtc atcaaggcag atgggttggc agctggcaaa       480
     ggtgtcatta tccctcaaac caaggaggag gcccacaaag cactccgcga aatgatgctg       540
     gatcatcact ttggagatgc tggtaatgag gttgttatcg aggagtatct tgagggtgat       600
     gaactcagta ttctcacctt cagcgacggc tatacgattc gctccctccc tccagcacag       660
     gatcacaagc ggatcttcga tggtgaccag ggccctaaca ccggcggaat gggctgctat       720
     gccccaactc ccatctcatc aaaggaggtt ctggaggaaa tcgaccgcac cattgtgcag       780
     ccgacaattg acggcatgag aaaggatggt ttcccctttg tgggtatcct attcaccggt       840
     ctcatgatga ccaaggacgg ccctaaggtc cttgaataca atgtccgtgg cggagacccg       900
     gaaacccaga ccttgctccc gttgctcagc gccgataccg acctggccca gatcatggtt       960
     gcttgcactg aacactggct tgacggtgtg gacatcaaga tcgagcccaa gttctctacc      1020
     accgtcattg cggtagctgg tggttacccc ggctcctacg ccaagggcaa ggcaatcact      1080
     ctggatccgg cacctgaaga cacattgatc ttccatgcgg gcacgaaact cttcggcaac      1140
     gaattgcaga ccaacggtgg ccgtgttatt gcttccaccg ctactgcgtc caccctcgag      1200
     gaagcactcc gcaagagtta cgctggcatc tcagcaattc actttgaaga catgttctac      1260
     cgcaaggata ttgcgcatcg tgccttcaga cagagagacg cagctgcttc ccagcagcag      1320
     cagtctctca cctatgcctc tgctggtgtg tccatcgacg cgggtaatga tctcgtcaac      1380
     aagattaaga gctgtgtcgc tcgtacgaag cgccctggca cggatgcagt gattggtggc      1440
     ttcggaggac tcttctccct tgccgccgcc aactctgcct accaccctga gtctcccact      1500
     ctgatcggag cgattgatgg cgtcggaacc aagttgaaga ttgcccacac tgtgggtgtg      1560
     cacaacaccg taggaatcga tctggtggcc atgaacgtca acgacttggt tgtccagggt      1620
     gccgagcccc tcttcttcct tgactgctac tcttgcggca agctggatgt cgagaccgct      1680
     gccgctttcg tggccggcgt cgcggacggc tgcgtccagg cgggctgtgc cttgatcggc      1740
     ggtgaaaccg cggagatgcc aggtctcttc gtcgacgaga cctacgacgc cgtgggtgcc      1800
     gccgtgggtg ccatcaacac caccggtaag aacgccaagt ccatcctgcc ggccacctct      1860
     gccatgcaag ccggtgatgt tctgctcgca ttggcgtcct ctggccctca ctccaacgga      1920
     tactcgttgg tccgcaagat cgtcgagaga tccggactaa gctacgacga ccctgccccc      1980
     ttcaccatgc cttcctcttc ctccgaatct ctgaccctgg gtcgcgccct cctcacccct      2040
     acccgcatct acgtcaagcc catcctgaag gctctgtcaa tcccgccctc caacagctcc      2100
     agcggttcct ccgccatcaa gggtctcgct cacatcaccg gtggcggtct ggtcgagaac      2160
     gtgccccgca tgcttccttc gaccctctcg gcacacatcg acgtctccgc ctggcaactg      2220
     ccccccgtct tctcctggct taagaagacc ggcaacgtca ccgcccccga gatggcgcga      2280
     gccttcaact gtggtgtcgg catggtcatt gtggttgaga agggatccga ggccgccgtc      2340
     aaagaactct tcgagaaaga gggtgaagtt gtctaccaag tcggtgaact caagcctcgg      2400
     caggacggcg aggaaggctg tgtgcttggg ggcttacaga cctgggatgc atga            2454
//

If you have problems or comments...

PBIL Back to PBIL home page