(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE358

ASFUM1_6.PE358       Location/Qualifiers
FT   CDS_pept        join(complement(1119387..1119485),
FT                   complement(1119061..1119321),complement(1118781..1118978))
FT                   /codon_start=1
FT                   /gene_family="HOG000200861" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265341"
FT                   /orf_name="AFUA_6G04760"
FT                   /product="UPF0220 domain protein"
FT                   /protein_id="EAL85564.1"
FT                   /db_xref="HOGENOM:HBG056182"
FT                   /db_xref="HOGENOM:HBG328134"
FT                   /db_xref="InterPro:IPR007919"
FT                   /db_xref="UniParc:UPI000051EF13"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDH4"
FT                   /transl_table=1
FT                   /translation="MEVSNNRLFRWSKPEWLNNSTIRNAGVYTSGALFSLGFFFLVDAA
FT                   AFSHSSRNGSKVHIKFVDWIPGICSALGMLVINSIEKSRLQADSFSYSGSGVAWKARFV
FT                   LFLGFALLAGGLAGSVTVMVLKYLIKQYPLPTLYFGIANVIANGLVMLRFVDVSPAAIH
FT                   LSRLLTGLLQYYCSMDLAEHRG"
     atggaagttt ccaacaaccg cctcttccga tggtccaagc ccgaatggct aaataattcg        60
     accatccgca atgcgggcgt ctacacgtca ggagctctgt tctccctcgg attcttcttt       120
     cttgtcgatg cggccgcatt ctcgcacagc tcccgcaacg ggtccaaagt tcacatcaag       180
     ttcgtcgact ggattcccgg catctgctcg gcgctcggga tgttggtgat caactcgatt       240
     gagaagtcgc ggctgcaggc ggatagcttc agctacagcg ggagcggagt ggcgtggaag       300
     gcgcggtttg tgctgttcct ggggtttgcg ctcctggcgg gtggtttggc ggggagtgtg       360
     acggtcatgg tcttgaaata tctgatcaag cagtacccgt tgccgacctt gtattttgga       420
     atcgctaatg tcatcgctaa cggcctggtc atgctaaggt ttgtcgatgt atctcctgca       480
     gctatacatc tgtcacggtt gctgactggt ttgctacagt actattgttc tatggatctc       540
     gcagaacata gaggatga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page