(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE359

ASFUM1_6.PE359       Location/Qualifiers
FT   CDS_pept        complement(1119889..1120560)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056659"
FT                   /orf_name="AFUA_6G04770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85563.1"
FT                   /db_xref="HOGENOM:HBG056181"
FT                   /db_xref="UniParc:UPI000051EA60"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDH5"
FT                   /transl_table=1
FT                   /translation="MASSLSHPSQHLQTFKIKRESEEPSLPLLEKMASQRSRSLSTGAN
FT                   MHPLRPSDLRNEQSRPGSRRSHFASRKNTPMPVESMSRREHSMALPSSDDKLEPSATPQ
FT                   DAQTIISENKNTITRTILTCMRLYGFNRSSRPTSTAKSGNGVDSDVNLSTEIGATSGTD
FT                   EDEFKAMYHATYRASTFALRKYLKQCPSTDGAVKDLPPLLDKEKAMTYIDEFLRLFCGE
FT                   V"
     atggccagct cactttccca tccatcccaa catctacaga ctttcaaaat caaacgtgag        60
     tctgaggaac catctctgcc gttattggaa aagatggcct ctcagcggtc gcgctcattg       120
     tccactgggg ccaatatgca tcccctcagg ccgtctgatc tccgaaatga acagtcccga       180
     ccaggcagtc gcagaagcca ctttgcttcg cggaagaaca cccccatgcc agtggaatct       240
     atgtcccgaa gggaacactc gatggcgtta ccatcttcgg acgacaagct ggagccttca       300
     gcgacacctc aggatgccca aaccatcata tccgagaata aaaataccat cactcgtacg       360
     atcttgacgt gcatgcgatt gtatggcttc aatcgctcgt cacgacctac aagcacagcc       420
     aaaagtggca atggggtcga ttcggatgtg aatttgtcca cggagatagg ggcaacttct       480
     ggtaccgacg aagatgagtt caaagcgatg tatcatgcaa cttatcgtgc atcaacgttt       540
     gccctccgca agtatctgaa gcaatgcccg agtaccgacg gggctgtaaa ggaccttccg       600
     cctttgctgg acaaagaaaa ggcaatgaca tatatagacg aattcttgag gctattttgt       660
     ggagaggttt aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page