(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE360

ASFUM1_6.PE360       Location/Qualifiers
FT   CDS_pept        join(complement(1122422..1122460),
FT                   complement(1122139..1122352),complement(1121884..1122017))
FT                   /codon_start=1
FT                   /gene_family="HOG000038515" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265342"
FT                   /orf_name="AFUA_6G04780"
FT                   /product="Vacuolar protein sorting 55 superfamily "
FT                   /protein_id="EAL85562.1"
FT                   /db_xref="HOGENOM:HBG327637"
FT                   /db_xref="HOGENOM:HBG379846"
FT                   /db_xref="InterPro:IPR007262"
FT                   /db_xref="UniParc:UPI000051EF12"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDH6"
FT                   /transl_table=1
FT                   /translation="MMAGLKTIIALSFVLAIGFLLVILSSALWHNFLPLIVVATYVIAP
FT                   VPNWICARCANPDDFMDSSGNAVADFGRFLTGFLVLMGVALPAVLAHSGAIQIPAMIMS
FT                   ILGGLLIYGTIISFSMFFKEQEEF"
     atgatggcag gtcttaagac aattatcgcg ctctcctttg ttcttgccat tggctttctt        60
     ctggtcatcc tctcctccgc tctttggcac aacttccttc cgttgattgt ggttgcgaca       120
     tatgtcatcg ctcctgtacc gaattggatt tgcgctcgat gcgcaaatcc ggatgatttc       180
     atggacagtt ctggtaatgc agtcgctgat tttgggcgat tcttgactgg cttcctggtg       240
     ttgatgggtg ttgccctgcc ggccgtgctt gcgcatagcg gagctatcca gatccctgcc       300
     atgatcatgt ccatcctcgg aggtcttctg atttacggca ctattatcag tttctcgatg       360
     ttcttcaagg agcaagaaga gttttga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page