(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE362

ASFUM1_6.PE362       Location/Qualifiers
FT   CDS_pept        join(complement(1125252..1125396),
FT                   complement(1124178..1124878))
FT                   /codon_start=1
FT                   /gene_family="HOG000156894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265343"
FT                   /orf_name="AFUA_6G04800"
FT                   /product="Lysine decarboxylase-like protein "
FT                   /protein_id="EAL85560.1"
FT                   /db_xref="HOGENOM:HBG388166"
FT                   /db_xref="HOGENOM:HBG437583"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="UniParc:UPI000051EF06"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDH8"
FT                   /transl_table=1
FT                   /translation="MSRDYRIQKRIRSSNIQLGCSYSTQNPLKMTHKTARKHGQAIGRN
FT                   AKRVANPSSCGSVAGNDPIHMETARALAHEFHKNNVQLVYGGGTKGLMGELARTLVSLS
FT                   GPQAVHGVIPRALVRVEPGYDNKREEEKPTASSGKSAERTIKEPLDKTALLGESEYGIT
FT                   TIVPDMHTRKRLMAEKVMAGGPGSGFVSLAGGFGTIEEVMEMTTWNQLGIHHLGIVLLN
FT                   VHGYWDGLLSWVQSAVKEGYIGADNGKILVEAKDPREVLPKLLEYRVSNGRMDLDWGQE
FT                   "
     atgagtcgcg actatcgcat ccagaaacgg attcgatcaa gcaatataca gctaggctgc        60
     agctactcaa cacaaaaccc actgaagatg actcataaga cggcgaggaa acatggtcaa       120
     gcaattggcc gtaatgccaa acgtgttgca aacccttcca gctgcggctc agtagcaggc       180
     aatgacccca tccacatgga aacggcgcgc gcgctcgccc acgaattcca caagaacaac       240
     gtccagctcg tctacggcgg cggcacaaag gggctaatgg gcgagctggc gcgcaccctc       300
     gtttccctct ccggcccaca agccgtgcac ggcgtgatcc cgcgggcgct ggtccgcgtt       360
     gaaccgggct acgacaacaa gcgcgaggaa gagaagccga cggcgagtag cgggaagagc       420
     gcggaacgga ccatcaagga accgcttgac aagactgcgc tgctggggga gtcggagtat       480
     gggatcacga cgattgtgcc ggacatgcat acgcggaagc ggctaatggc tgagaaggtc       540
     atggcggggg gccctggatc gggcttcgtg tcgctggcgg gtgggtttgg aaccattgag       600
     gaggttatgg agatgacgac atggaatcag ctgggtattc accatctggg gattgtgttg       660
     ctgaatgtcc atgggtactg ggatgggctg ctgtcgtggg tgcagagtgc cgtcaaggag       720
     gggtacattg gggcagacaa cggcaagatc ctagtcgagg cgaaggatcc tcgcgaggtt       780
     ctgccgaagc tgctcgagta ccgggtcagc aatggcagga tggacctgga ttggggccag       840
     gaatga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page