(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE365

ASFUM1_6.PE365       Location/Qualifiers
FT   CDS_pept        join(complement(1135638..1135765),
FT                   complement(1130556..1135574),complement(1130427..1130503),
FT                   complement(1130184..1130254))
FT                   /codon_start=1
FT                   /gene_family="HOG000200826" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207951"
FT                   /orf_name="AFUA_6G04830"
FT                   /product="HATPase_c domain protein, putative "
FT                   /function="ATP binding"
FT                   /protein_id="EAL85557.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG056176"
FT                   /db_xref="HOGENOM:HBG328094"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR022155"
FT                   /db_xref="UniParc:UPI000052045A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDI1"
FT                   /transl_table=1
FT                   /translation="MARNIDFNALKARTMGSGNDEEAVTVDTRGLISKVLARYSGKWTV
FT                   LREMIQNAADANATKVTIKFETLPSTTVPLPSSADQTTLLKHTISHHTLKRLLISNNGL
FT                   PFSEKDWARLKRIADGNPDETKIGAFGVGFYSVFDDCEEPFVSSGKDAMAFYWKGNALF
FT                   TRRLQLSEESNPETTFVLDYRNDTSPVPSLMQLSQFLSSSLTFVSLESIELWLDDWDLL
FT                   RLVKKTAPSVNLTIPKDIETKTPQGLMKVTGITREVVQVDAAWMRVVEWNPNASVFRLD
FT                   GLRDTTGSLRTFFSRLTGQSTQENPVKTEKPENIIDCGDLTTVLKASVFLHISTASIQC
FT                   SVSHSLSSELERATRKPPPKRTTLAILTPSYDTDVASGASTSRSDILSSILPKKTGRVF
FT                   IGFPTHQTTGLNAHISAPSVIPTVERESIDLNTRYISKWNLEMLRAAGIVCRVAWSAEM
FT                   ASIKSRILSKIDSSKSSKIRKGDIVGVLPEAIYTANQFVFRESTPSSVLGQTIEDAFWT
FT                   CNKNASIEVLSTCGIIQSHQARIAPKDLSFMDSIPVLPDELVSGAKDFVRKLTDFGLVS
FT                   EVTVSDIKRELEASTLRPGQVIEFLGWLSRKATSGQLDSFSIQSLLSVAVANDEDSSGN
FT                   PSRLLVFGDINNFLNPQRIPVDLPVPSSVIPFKYSKSLSKQELEALGWTELQTVPWIRW
FT                   LVINASNRDVLPLEQDITQSPSFSAQVLPVLSKQWDNSLSQSSKQTIISLLQSQTVIPT
FT                   KLGMKRPAETYFSSVRLFDDLPVVHGLNSVKEKFLMALGVRKTVELGVIFERLLDNPQA
FT                   SDGKSDNQRKWSHVDLIRYLASVRDDIPANDIKRLKDTSICTAEATEHSKPAGGKRYKI
FT                   SELFEPKGSLRDLGLPILEWPGKYQPSSNEGKFLTMLGLRSFPSAPEMVNVMAKAAAAD
FT                   DWDLHGKAMSYYISEYHTNGYATFDCSAVNVPFLPIEGARDLSTPNRCFTDEGATLFGF
FT                   KILRRDLHPHASKFGVKQHAAMTNCLDYMIRHPPSTKRDARVLFKYLAGRVAELSARDI
FT                   ERTGNAKIVPIAIRDTVEQGSVVRRVAPKLCYLGEGEDYRDIFDFVDFGQEANLFLMAV
FT                   GSKREPTKTELAYMLVKEPARISASFQSADKYLKLLRSLAEHLAVLRRDKELFNEMKRS
FT                   AFLLASRDITSLAQGGAKSEDLLGSDDDEVEDQSIKEWTLTAATDAVVVDDFQSFNLFK
FT                   EHILAAPQEELLENFYTALGAIPLSGLVEERANWGAVAHDQRPAAKLHKLINERSRLFL
FT                   HDQSPDSIRHDVRWLEKNLQVQVVNSISLTRSLKGRRVSHTQKRSAIITQNGRTWILWI
FT                   CPGKYDLYEISQALVHLILVRPKLHSTLTLEMLLKTDLLELKARGYNVERILKQKAQEA
FT                   KIAEDRRQKQLEEERQRLEEREAAWAKEQAQLQAQEREMEAKSQPLMPGDFPDSPTNKG
FT                   SNPNVEAEATETLQERRPRGLFANLTKRFGLEGGRSSWNPLGGQPSPPQPGGTPEPTGT
FT                   PPPPYSADDPQRPRPEEPAPVHPPHRLQNELLSAIQACRPHGSSSLYSRPETNEVTETK
FT                   SYCDEKPSHDLEFVATLPCGINVLFVKTLADRSAFLSKNSAGINLFAALLIECASVFSL
FT                   RKDSLSVFYDPGGKTIAFNRAGSIFCNYFYFQQLHEKELLQNQSADRSESMVYWWVILC
FT                   HELAHNLVGDHSSAHSYYSEGFVAQYFPKIAVKLANASQPKSGSSFSWSLRTWSGKQAG
FT                   FMDIQIDN"
     atggcgagga acatcgactt caacgcgctg aaggcgcgga cgatgggctc agggaacgac        60
     gaagaggctg tcactgttga cacacggggc ttgatatcta aggtcctcgc acgatattca       120
     ggaaaatgga ccgttctacg agagatgatc cagaatgcgg cggacgcaaa tgctaccaag       180
     gtcactatca agtttgagac tctgccttct acgactgtac ccttgccttc tagcgccgat       240
     cagactacct tgttgaagca caccatatcc caccataccc tcaagcgttt gttgatctcg       300
     aataatggcc ttccttttag cgagaaggat tgggcaagac taaaacgtat tgcggatgga       360
     aacccagatg aaactaagat cggcgcattt ggtgtcgggt tttacagtgt ctttgatgac       420
     tgtgaagagc cttttgtgtc ttcaggcaaa gatgcaatgg ctttttactg gaagggaaac       480
     gcgctattta cacgtcgctt gcaacttagc gaagagtcga atccagaaac aacatttgtg       540
     cttgactatc gcaacgatac ttctccggtt ccgtctctga tgcagctgtc ccagttctta       600
     tcaagcagtc ttactttcgt cagtctcgag agcatagaat tatggcttga tgactgggat       660
     ctcctgcgcc tcgtgaagaa gacggcaccc agcgtcaatc tgacgatccc caaagacatc       720
     gaaactaaga cgccccaagg cttgatgaaa gtaacaggta tcactcgaga ggtcgttcaa       780
     gtcgatgcag cctggatgcg tgtcgttgag tggaatccga acgcaagcgt gtttcgcttg       840
     gacggactga gagataccac aggctccttg cgtacctttt tttcccgact caccggccag       900
     agcacacaag agaaccctgt aaagaccgag aagccggaaa acatcatcga ttgcggagac       960
     ttgaccaccg tcttgaaagc atccgttttc ttacatatca gcactgcaag tatccagtgt      1020
     tctgtcagtc actccctgag cagcgagctt gaacgagcta cgcgcaagcc tccacccaaa      1080
     cgaaccaccc ttgcgatact tacgccttcc tatgacacgg acgttgcatc gggagcgtca      1140
     acatcacgat cagatatcct atcctccatt ctacctaaga agactggaag ggttttcata      1200
     ggatttccca ctcaccagac aacaggattg aacgctcaca tatctgcgcc ttcagtgatt      1260
     ccgacggtcg aaagagagag tatcgacctc aatacgagat acatcagcaa atggaacctt      1320
     gaaatgttac gagcggctgg aatagtctgt cgagttgctt ggtccgcaga aatggcatcg      1380
     atcaagtcca gaatcctgtc caagatagac tcttccaagt catcgaagat ccgaaaaggt      1440
     gacattgttg gagtcttgcc tgaagcgata tacaccgcga atcagtttgt gttccgcgag      1500
     tcgacgccgt catcggtatt aggtcaaact atcgaagacg ccttctggac atgtaataaa      1560
     aacgcgtcca tcgaggtact gtcgacatgt ggtattatac aaagtcatca ggcacgcatt      1620
     gctcccaaag acttgagctt catggactct atcccggttc tgccggatga gcttgtgtcg      1680
     ggcgcaaaag atttcgtcag aaaattaact gattttgggc tggtctctga agttaccgtc      1740
     tcggatatca agcgagaact cgaggccagc accttacggc ccggccaggt cattgaattt      1800
     cttggttggt taagtcggaa agctacttca gggcaacttg attcattctc aatccagagc      1860
     ctcttaagtg ttgcagtggc aaatgatgaa gatagctccg gcaatccttc ccgactactt      1920
     gtctttgggg acattaacaa ctttctgaat ccccagcgta tacctgttga tctgcccgtg      1980
     ccgtcctcgg tcataccttt caaatactcc aagtctctct cgaagcagga actggaagca      2040
     ctcgggtgga cggagcttca gacagtccct tggatccgct ggcttgtcat caatgctagt      2100
     aatagggatg ttctcccgtt agagcaagat ataacgcagt cgccgtcctt ctctgcgcag      2160
     gttcttcctg tcctgtcgaa acaatgggat aacagcctga gtcagtcatc gaagcagacg      2220
     ataatctcgt tgttgcagtc gcagacagtc attccaacca aacttgggat gaaaagaccc      2280
     gctgagacat atttctcttc agtgaggctg tttgacgacc tcccagttgt ccatggcctc      2340
     aatagtgtta aggaaaagtt cctcatggcg cttggcgttc gtaaaactgt cgagcttggc      2400
     gtcatttttg agcggctcct cgataacccc caagcttccg atggcaagag cgacaatcaa      2460
     cgaaagtgga gtcacgttga tctcatacgt tatcttgctt ctgttcgcga tgacatcccg      2520
     gcgaatgaca tcaaaagact taaggatact agcatttgca ccgccgaagc aacagaacac      2580
     tcgaagccag caggtggaaa gcgatataag atttctgagt tgtttgagcc gaaaggttcc      2640
     cttagagacc ttggtctccc catcctcgaa tggccgggaa aatatcagcc aagcagcaat      2700
     gaaggaaaat tccttaccat gcttggtttg aggagtttcc cgtcagcgcc tgagatggta      2760
     aatgttatgg caaaggcggc tgctgcggat gactgggatt tgcacggaaa agctatgtct      2820
     tactatattt ctgagtatca tacaaacggt tatgccacgt tcgattgcag tgctgtcaat      2880
     gttccgtttc tgccaattga aggggctcgc gacctgagca cgccaaacag atgtttcact      2940
     gatgaaggcg caacactgtt tggttttaag attctccgac gtgaccttca ccctcatgct      3000
     tcgaaattcg gggtcaagca gcacgcagcc atgacgaatt gtctcgatta catgatccgt      3060
     catccaccat ccacgaagcg agacgcaaga gtgctgttca agtatcttgc cgggagagta      3120
     gcggagctaa gcgcacggga tatagagcgt actggtaatg caaaaattgt cccgattgca      3180
     ataagggata cagtcgagca aggttcggtt gttcgtcgtg ttgcgccgaa gctatgctac      3240
     ctcggagagg gcgaagacta ccgagacatc tttgactttg tggatttcgg tcaagaagcc      3300
     aatctcttcc tcatggcagt tgggtctaag agagagccaa cgaagaccga acttgcctac      3360
     atgctagtca aagaacctgc taggatttct gcttcttttc agagtgccga caagtatctc      3420
     aagctcctga gaagtcttgc agagcacctt gccgttctga gacgggacaa ggaactcttt      3480
     aatgagatga aaagatccgc ttttcttctg gcgagtcggg atatcacctc tctggctcag      3540
     ggaggcgcca agagcgagga tcttctgggc tccgatgacg acgaggtaga agatcagagc      3600
     atcaaggaat ggacgttgac cgctgcgaca gatgcagttg tggtggatga ttttcagagt      3660
     ttcaaccttt tcaaagagca catactagct gccccgcaag aggaattgtt agagaacttc      3720
     tacactgcac tcggggctat tccattaagc ggactggtgg aggaacgtgc caactgggga      3780
     gctgtggccc acgatcagcg tccagcggct aaactacata agctgatcaa cgagcgttca      3840
     aggttgtttc ttcatgatca atccccggat tcgattcgcc acgacgtcag atggctggag      3900
     aagaacctcc aagtgcaggt tgtgaactcc atttcgctca cgcggtctct caagggccgt      3960
     cgggtgtcgc acacacagaa acggagtgcc ataatcaccc agaacggacg aacttggatt      4020
     ctctggatct gtcccggcaa atacgacctc tacgagatca gtcaagctct tgtacatctc      4080
     attctcgttc ggccaaagct ccattccacg ctcaccttag agatgttgct gaagactgac      4140
     ctcctagaac tgaaggcacg aggatataac gtggagagaa tattgaagca aaaggcacaa      4200
     gaggccaaga tagccgagga tcggcgtcag aaacagttgg aagaggaacg acagcggcta      4260
     gaagagagag aagccgcctg ggccaaggaa caggctcaac tccaggcaca agagcgggag      4320
     atggaagcga agagtcaacc tctcatgcca ggtgattttc ccgactcacc cactaataag      4380
     gggtcgaacc ccaatgtgga agccgaagca acagagacgc tccaggagcg gcgtccgcgc      4440
     ggtttgtttg ccaacctgac caagcgattt ggtttggaag gtggccggtc gagctggaat      4500
     cctctcgggg gacagccatc gccaccccag cctggtggaa caccggagcc tacaggcacc      4560
     cctcctccgc catattctgc agacgaccct cagagaccgc gcccggaaga acccgcgcct      4620
     gtgcatcctc cgcatcggtt gcagaacgag ttgctctctg ccattcaagc ctgccggcct      4680
     catggatcgt cgagcttgta cagccggccg gagacgaatg aggtcactga gacgaaatcc      4740
     tactgtgacg agaagccaag ccatgacttg gagttcgtgg cgactctacc ctgtggaatc      4800
     aatgtgctgt tcgtgaagac tctagctgat cgatccgcat tcctatccaa gaacagtgct      4860
     ggaatcaatt tgtttgctgc cctgttgatc gaatgtgcta gtgtcttttc actgcgtaag      4920
     gacagtctta gtgttttcta cgacccgggt ggaaagacta tagcattcaa ccgggctggc      4980
     agtatcttct gcaactactt ctacttccag cagctgcatg aaaaggaatt gcttcagaac      5040
     cagtcggctg acagatctga atcgatggta tactggtggg tcattctctg tcacgaatta      5100
     gcccataacc tagtgggaga ccatagctcc gcccacagtt actacagtga gggctttgtg      5160
     gcgcaatatt tccccaagat cgcggtcaag ctggccaacg caagccagcc aaagtcaggc      5220
     tcaagcttca gctggagctt gagaacctgg agtggcaagc aggcaggctt tatggacata      5280
     caaattgaca actaa                                                       5295
//

If you have problems or comments...

PBIL Back to PBIL home page