(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE369

ASFUM1_6.PE369       Location/Qualifiers
FT   CDS_pept        join(1145681..1145702,1145801..1145845,1145919..1147037,
FT                   1147100..1147581)
FT                   /codon_start=1
FT                   /gene_family="HOG000200782" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265347"
FT                   /orf_name="AFUA_6G04860"
FT                   /product="MBOAT family protein, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85553.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG328785"
FT                   /db_xref="HOGENOM:HBG737510"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniParc:UPI0000F51CD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDI5"
FT                   /transl_table=1
FT                   /translation="MLPYVDTIFGYPARLTGASVDELKLIASFLLSYPLAGLLKRIPDA
FT                   HPWKKNVFIIAVSLFYLVGLFDLWDGLRTLLYSAAGTYAIAYYIDGSLMPWIGFVFLMG
FT                   HMSISHIYRQMVDDPQVVDITGAQMVLVMKLSSFCWNIHDGRLPQDKLSDPQKYASIAQ
FT                   FPSILDYAGYVLFFPSLFGGPSFEYVDYRRWLDTTLFEVPPGTDPSKVPPTRKKRKIPR
FT                   SGTPATKKALMGLVWIFVFLQLGSLYNKESVLGESFLSYSFLRRVWILYMLGFTTRTKY
FT                   YGVWSLTEGACILSGLGYNGFDPKTGKVFWNRLDNIDPWSLETAQNSHGYLGSWNKNTN
FT                   HWLRNYVYLRVTPKGKKPGFRASLATFTTSAFWHGFYPGYYMTFILGSFVQTGAKNIRR
FT                   YIRPFFLTPDGAKPLPTKRYYDILSWLVTQLTMSFVVMPFIFLSFSSSIQVWRSVYFYG
FT                   IIGNIMSIIFFASPAKGYLVRSLKKRNKPHIPRTASMESLQQPTLGLPNDPAREFDDAV
FT                   QEIKAEFEARRRRGSVVGVPTGEELKAAVEAKLGRKIS"
     atgttacctt acgtcgatac tatattcggg tatcctgcaa ggctcacagg agcttcggtg        60
     gatgagctca agcttattgc atcattcctg ctctcctatc ctttggccgg tctgcttaag       120
     agaattcccg acgctcaccc ctggaagaag aatgtcttca ttatcgccgt ttccctgttc       180
     tacttggtcg gtttattcga tctgtgggat gggttgcgca ctctgctcta cagtgctgct       240
     ggcacctacg ccatcgcata ctacatagac ggctcgctga tgccatggat cggctttgtc       300
     tttctaatgg gccatatgtc catcagccac atttaccggc agatggttga cgatcctcaa       360
     gtggttgata tcaccggcgc acaaatggta ctcgtcatga agctttcctc cttctgctgg       420
     aacattcacg acggccgttt accgcaagac aagctgtcag atccgcaaaa gtacgcttct       480
     attgcacagt tccccagcat cctggactat gcgggatacg tcttgttctt tccatcttta       540
     ttcgggggtc cgtctttcga atatgtggac tataggcggt ggcttgatac gacgcttttc       600
     gaggtgccgc ccggaactga tccgtccaag gtgcctccaa cccggaagaa gcgcaaaatt       660
     ccccgtagcg gcacgcctgc gaccaagaaa gctttgatgg gtttggtatg gatctttgtg       720
     ttcttgcaat tgggctctct ctacaataag gagtcggtgc ttggagagtc cttcctgagc       780
     tattcatttc ttcgacgagt ctggattctt tatatgctcg gattcaccac acgaacgaaa       840
     tattacggtg tatggtctct taccgaaggt gcctgtattc tatctggact cggatacaat       900
     ggctttgatc ctaagacagg caaggtcttc tggaaccgct tggataacat tgacccctgg       960
     agccttgaga cggcccaaaa ctcacatgga tacttgggga gctggaacaa gaacacgaac      1020
     cactggcttc gaaactatgt ttacctgcgc gtaacaccca agggaaagaa gccagggttc      1080
     cgagctagtc tggctacatt cacaaccagc gcattttggc acggatttta ccctggctac      1140
     tacatgacgt ttatcctggg gtcttttgtc caaaccggag ctaaaaacat ccggcgttat      1200
     atccgtccgt ttttcttgac tcctgatggc gctaagccgc tacctaccaa acgctattat      1260
     gatatcctca gctggcttgt tacgcaacta accatgtcct ttgtcgtgat gccgttcatc      1320
     ttcctgtcgt tcagttcgtc catccaggtt tggcggagcg tgtatttcta cggcattatt      1380
     ggaaacatca tgtccatcat cttcttcgcc agcccggcaa agggatatct tgttcgatcc      1440
     ttgaagaagc gcaacaagcc acacatccca cgcactgcca gcatggaaag tctccaacaa      1500
     ccgacccttg gtctcccgaa tgaccccgct cgggaattcg atgatgcagt ccaggaaatc      1560
     aaggctgagt ttgaggcgcg aagaagacgt ggcagtgtgg tcggagtacc aacaggcgag      1620
     gaactgaagg ccgccgtgga ggccaagctt ggtcggaaga tctcgtga                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page